Super market software vb net punët
Eshte nje projekt super i bukur nga donald bukuroshi
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
eclipse php software update in eclipse IDE
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
Potrebna mi je konfiguracija nasog OpenCart shopa za srpsko trziste. Porzes, mogucnosti placanja etc. Uz to treba i manji redesign i posle sajt optimizacija za google. Petreban je freelancer iz srbije / hrvatske za duzu saradnju. Nebi bilo ni problematicno da promenimo sistem (magento) I need help about my shop site - currenty Open Cart System - for the serbian market. The VAT and checout configuration hast ot be made, and some smaller backend tasks. Also I woul dlike to redesign some elements of the current theme - nothing special. And further I will need SEO (clothings). I am looking for a serbian / croatian freelancer to work with permanent.
WE NEED IPTV APP FOR ANDORID WITH ADMIN PANNEL IN PHP TO MANAGE CUSTOMERS . i MUST BE AS THIS IN LINK LOOK THE VIDEO
Software para embarcar hardware Wireless 5.8 GHz MIMO e SiSO, com chipset AR9344
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
qeq kwoekqwoepqwjeoiqwjeoiqj eqwjejwoi ejwqoieqwj oeqwjoejqwoejqwioej qwioejqw oijeqwioejq wejwqio
I'm seeking a professional CV writer to craft a top-notch resume for a job application within the Technology industry. This CV should be specifically tailored towards an executive-level position. It should be persuasive and able to highlight my significant achievements in the tech industry while demonstrating the skills and experiences that make me a fit for top executive jobs. Ideall...executive-level position. It should be persuasive and able to highlight my significant achievements in the tech industry while demonstrating the skills and experiences that make me a fit for top executive jobs. Ideally, you should have experience in writing CVs for top-level tech industry professionals. The completed CV should also be compliant with ATS screening, and ultimately help me standout in the...
I'm looking for a seasoned researcher who can provide me with a comprehensive analysis of the best food franchises in Jaipur, India that fit within a...analysis background, preferably within the food industry. - Previous experience in the franchise sector would be a significant advantage. - Knowledge of the Jaipur market would also be a plus. Key Requirements: - A detailed, well-structured report on the researched franchises with a focus on the brand OneBite Tealogy. - The report should include market insights, financial requirements, and competitive analysis. - A summary outlining the pros and cons of each franchise option. The chosen candidate will play a key role in shaping my decision-making process, and in helping me to identify the most viable investment options...
...looking to create a comprehensive web-based accounting software with essential features that will allow me to manage my finances, track inventory, generate GST reports, and handle billing. This software should also support up to 5 users. Key Features Needed: - Financial Management: The software should offer robust financial management functionalities to help me track and manage my finances effectively. - Inventory Management: A sophisticated inventory management system is required which involves product categorization, stock monitoring, and purchase order tracking. - GST Reporting: The software should have the capability to generate accurate GST reports in compliance with the relevant regulations. - Billing Features: I would require the software to su...
...my users' dashboard to the latest Angular version. The primary focus of this project is to optimize the dashboard's performance through responsive design. Key requirements: - Need to complete user dashboard UI from .NET API to the latest Angular version - Implement a responsive design to enhance load speed and overall performance - Prioritize optimizing charts and data visualization for a better user experience This project will require strong expertise in Angular, particularly in developing responsive designs. The ideal candidate should also have experience working with .NET APIs and be able to effectively optimize data visualization for improved performance. If you have a solid background in these areas and can deliver a high-quality, responsive user dashbo...
...the cryptocurrency market. Key Requirements: - Develop a custom EMA strategy: I'm looking for a tailor-made EMA strategy that will help me to effectively analyze the cryptocurrency market. - Implement strategy on TradingView: The strategy will need to be integrated into TradingView, a platform that I am comfortable using. - Alerts for EMA crossovers: The strategy should include alerts for EMA crossovers, which are a key component of the trading approach I'd like to take. Ideal Skills and Experience: - Extensive experience with TradingView: You should be well-versed in using and customizing indicators on the TradingView platform. - Proficiency with EMA strategies: A strong background in developing and implementing EMA strategies, particularly in the cryptocurren...
I'm see...will be valuable to understand how other brands like Nike, Adidas, and Apple are being displayed in the retail outlets. - Customer Behavior: I'm particularly interested in how the retail displays are shaping customer behavior and purchase decisions. Ideal candidates should have a background in visual merchandising, market research, or a related field. Specific qualifications include: - Proven track record in conducting retail research, especially within the Chinese market. - Strong analytical skills to interpret the data and provide meaningful insights. - Familiarity with art supply brands and the retail industry would be beneficial. The output of this project will be a detailed report with actionable recommendations for optimizing Talens'...
I'm in need of a 3D architectural video that is five minutes long, aimed at promoting and marketing a property. Key points: - The video should have a sharp focus on interior details, exterior views, and the surrounding environment. - The primary goal is to market the property effectively, so the video should be visually appealing and professional. - Since it's a longer video at 5 minutes, it's important to maintain viewer engagement. Ideal skills and experience: - Proficiency in 3D architectural visualization and animation - Previous experience with creating marketing videos, particularly in the real estate sector, would be a significant advantage - The ability to work with the provided content (interior details, exterior views, and surrounding environment) and t...
I am seeking an experienced SEO consultant...consultant with a proven track record in gaining top search results on Google, specifically within the local market. Key responsibilities and features include: * Optimizing my website for Google's algorithm to place it within the top 5 search results * Focused targeting of the local customer base for my escort service * Carefully balanced keyword use, revolving around the terms related to escort service and call girls, to increase visibility among local searches without overstuffing Expertise Needed: * Strong knowledge of Google's ranking algorithms * Experience with local SEO * Prior success in bringing websites to top search rankings * Understanding of the escort service market is a plus but not necessary. Looking...
I'm in need of a software developer who can assist me in creating a software application that can search through public property records and monitor for changes, sending notifications through a dashboard. Key Requirements: - Develop a software application capable of searching through public property records. - Implement a feature that allows the software to monitor these records for specific changes. - The software must be able to send notifications regarding these changes through a dashboard. Ideal Skillset: - Proficiency in software development and programming. - Experience in database management and data analysis. - Familiarity with creating software for monitoring data and sending alerts. - Ability to create a user-friendly dashbo...
...incorporates various elements such as revenue streams, costs, and growth potential. - Design Go-to-Market Strategy: This will involve formulating a detailed plan on how we can enter and penetrate the US and Mexican markets, highlighting key milestones and tactics. Requirements: - Expertise in Financial Modeling: Demonstrated experience in developing financial projections, especially for technology companies targeting international markets. - Proven Track Record: We are looking for someone who has a strong background in creating successful go-to-market strategies for companies in similar industries. - Market Research Skills: While we have existing data on our target markets, the ability to conduct additional market research to refine our strategy would be a p...
looking for an expert in video analytics to help with a live stream volume calculation project for inventory management. Key Requirements: - Utilizing video analytics to calculate and track volume - Developing a system to process live streaming video feeds - Find volume of a dirt pile using multiple fixed cameras and any other needed sensors in .NET core C#. Examples of apps already built - URC Ventures Stockpile Reports Lite iPhone app; ; Use openly available camera appliances so we shall be independent of any specialty vendors. Please provide testing procedures and testing tools in simulated conditions. If some 3rd party tools are used, our pre-approval, source codes and unlimited licenses be included, meeting
I'm seeking a skilled C# .net developer to improve the performance of my application. - Scope: The project involves fine-tuning the existing codebase, optimizing database queries, and enhancing the overall performance of the application. - Skills: The ideal candidate should have a profound understanding of C# .net development, experience in performance optimization, and a strong grasp of database management. If you're proficient in identifying bottlenecks and implementing solutions to boost system speed and efficiency, I'd like to hear from you. Please share your past relevant experience.
J'ai besoin d'aide pour finir le design d'un site web, j'ai eu une super mauvaise expérience avec la compagnie qui a créer mon site web, ils m'ont remis un travail à moitié, je n'arrive pas à changer les photos moi même.
...which customers visit. I need a comprehensive geo-targeting report for a US-based business. The report will primarily focus on a specific city, state, and country, delving into neighborhood-level and county-level details. Key Requirements: - **Geo-Targeting:** The report should provide a detailed understanding of the demographics and market behavior of the specified locations. - **Competitor Analysis:** This will involve a thorough investigation of the market, outlining the competitive landscape and the strategies employed by competing businesses. - **Customer Behavior Data:** I would like the report to include detailed insights into customer behavior in the target locations. The ideal candidate for this project should have: - Proven experience in conducting geo-targeti...
I am looking for a skilled programmer who can adjust my self-developed trading strategy on TradingView into a system that can place limit orders on the trading platform, currently its market orders. Key Requirements: - Take the signals generated by my proprietary trading strategy and convert them into actionable limit orders. I need this project completed as soon as possible. This needs to happen so as to sent webhooks to ninjaview which sends them to ninjatrader
I'm in need of a sales representative who will focus only on the local geographical area of my lawn care business. The ideal candidate will be responsible for not only developing and maintaining relationships with pot...area of my lawn care business. The ideal candidate will be responsible for not only developing and maintaining relationships with potential and existing customers but doing so with a specialized knowledge of lawn care services. Essential skills necessary for this role include: - In-depth knowledge of lawn care sales - Strong relationship-building skills - Effective sales strategies - Local market understanding Experience in both the lawn care industry and sales is desirable but not an absolute must if the candidate exhibits a strong understanding and passio...
...in the forex market in a zigzag pattern. - Pivot Indicator: It should also be able to calculate and mark pivot points based on the price action. - Customizable: The indicator should be flexible and adjustable to my specific trading strategies and preferences. - User-Friendly: It should be easy to use and understand for a trader, with clear visual markers and alerts. Skills and Experience: - Proficient in TradingView's Pine Script language. - Strong understanding of forex market dynamics, including pivot points and zigzag patterns. - Experience in developing custom indicators for trading platforms. - Ability to incorporate user-defined rules and preferences into the indicator. This project requires a developer with a deep understanding of technical analysis in the fo...
I am in need of a door to door sales agent who can strate...agent who can strategically promote and oversee the sale of our non-alcoholic drinks line targeting adults aged 25-55 in physical retail stores. What I require: - Creative ideas to market non-alcoholic beverages. - Understanding of the tastes and preferences of adults aged 25-55. - Experience in promoting products in physical retail stores. - Proven track record in similar markets. Ideal skills/experience: - Marketing & sales strategy - Physical retail promotional tactics - Consumer behavior understanding among adults - Prior experience in beverage marketing Achieving a connection with our target market is paramount. If this suits you, please bid with a summary of your strategy and experience catering to ...
I'm looking for an expert in the domain flipping business to help me sell a small collection of domains that I own. Key Responsibilities: - Evaluate and determine the market value of each domain - Create compelling listings for each domain, highlighting their potential value and target buyers - Promote the domains across appropriate platforms to maximize visibility - Handle negotiations with potential buyers and finalize domain sales Ideal Skills and Experience: - Proficiency in domain flipping or a related field - Strong understanding of the domain market and what makes a domain valuable - Excellent written communication skills for creating persuasive listings - Experience with online sales platforms and negotiating sales - Proven track record of selling domains at a...
I'm in need of a comprehensive business plan, specifically tailored for my precision agriculture venture. - **Objective**: The main focus of this business plan is to outline the business goals and strategies. - **Industry**: The project is in the prec...goals and strategies. - **Industry**: The project is in the precision agriculture sector. - **Specific Goals**: * A key goal of this venture is offering a cost-effective agriculture drone capable of carrying up to 250lb. Ideal freelancer for this project should have: - Proven experience in writing business plans, especially within the technology or agriculture industry. - Ability to conduct market research and provide detailed industry analysis. - Excellent communication skills to effectively articulate the business stra...
I'm seeking a professional experie...a professional experienced in algo trading in the stock market to manage my trading position. Knowledge and expertise in the following areas would be beneficial: - Day Trading: Your main focus should be on day trading strategies. Your ability to stay ahead of real-time news and trends is essential in securing high yield returns. - Moderate Risk: While I'm open to a moderate level of risk to achieve my day trading investment goals, it's crucial to maintain a strong stance on risk mitigation strategies. Professional favorites in financial markets, trading algorithms, and risk management under medium-risk settings would be an excellent fit for this role. Please share any similar previou experience or successes within the stock m...
I need two stand-up banners designed for my jewellery business. The theme should be centered around elegance and sophistication. The banners will be used for promotional purposes at an upcoming event. Key Requireme...Partner BIG Swarovski Logo at bottom website: Instagram Handle: mehrozdesignerjewellery 2nd Banner: NEO Restaurant Logo Now Home of Mehroz Designer Jewellery Logo Discover Mehroz Designer Jewellery: Innovative Silver Creations with Precious Gemstones, Swarovski Crystals, and Lab-Grown Diamonds. Custom Gold Jewellery in 21, 22, and 23-Carat Gold – Guaranteed to Beat Market Prices and Quality! at bottom website: Instagram Handle: mehrozdesignerjewellery Please provide examples of your previous similar work when applying.
Comprehensive Business Plan & Market Research
I'm looking for an e-commerce website that can sell a single digital product - a software. The key requirements for this project are as follows: - **E-Commerce Functionality**: The website should essentially operate as a single product online store, optimized for sales of the software. - **Digital Product Delivery**: After a successful purchase, I'd like the software to be delivered via email with a secure download link. - **Payment Integration**: The website should have seamless integration with both Credit Card and PayPal payment gateways. Skills: - Proficiency in e-commerce website development - Experience in digital product sales platforms - Payment gateway integration expertise, especially in Credit Card and PayPal - Strong understanding of securit...
...booklet should be 24-pages long, a5 sized (6 a4 sheets folded in half to A5 size). - The design style should be traditional and elegant. Content: - I'm keen to include information on local property values in the booklet. This is crucial for potential clients who are interested in the real-estate market in our locality. Skills and Experience: - I expect the designer to have experience in creating similarly styled elegant and traditional designs. - A good understanding of the real-estate market or experience in designing for estate agencies would be a plus. - The designer should be able to translate information on local property values into a visually appealing and engaging format. If you think you're up to the task, I'm eager to view your portfolio and ...
...looking for a photographer with experience in product photography. There are two aspects to this project - 1. educate me on the art of product photography using the equipment I have available to me and 2. photographing products. The applicant should be highly creative and able to suggest original ways to photograph products to be eye-catching and appealing to shoppers in a highly competitive market. Initially this will be a one or two-session project at my location however there is ample opportunity for future work taking photographs for me when I either 1. don't have time or 2. just don't want to do it. The option to take photos offsite is acceptable. This person should be able to capture the essence of a diverse range of products, including jewelry, handbags, acc...
...partnerships within the finance industry for my B2B SaaS software. Your key responsibilities will be to cultivate these relationships, pitch our product to potential clients, and ultimately contribute to the growth of our service. The ideal candidate would be a Sales Executive who is looking to build a career in business development and sales. Although prior experience is not necessary, a basic understanding of the finance industry is beneficial. You should also be a motivated self-starter with excellent communication skills. Key Responsibilities: (Business Development Executive) (with good track record) + Must have strong Sales Managerial Experience in any B2B SaaS company OR been as a Sales Partner. + Experience in dealing with B2B + USA Market + Must be interested in...
I'm looking for a proficient ASP .NET MVC developer who can help me create a web application with a specific focus on music streaming. Key functionalities of the project include: * Building the web application from scratch with ASP .NET MVC * Synthesizing a user registration system. It's essential to track user activity for future features, but no user login will be required to access content. * Establishing a data analytics feature. This data should be accessible to admins and will be used to gauge user preferences and activity. * Incorporating real-time notifications. This functionality should alert users of new content, primarily new music uploads. An essential part of this project is the local storage and streaming of music files. These files need to be store...
I am looking for a software designer who can help me build a payment processing company similar to VISA INC, while ensuring that the company complies with all relevant laws and regulations in North America. Key Requirements: - I want the company to focus on payment processing. - The software must include a mobile-friendly design to cater to the increasing mobile transaction trend. - The payment gateway should be integrated into the system to provide a seamless, secure transaction experience. - An inventory management system is also crucial for our operations. Ideal Skills and Experience: - Proven experience in designing and developing payment processing systems. - In-depth knowledge and understanding of North American regulations and compliance requirements. - Strong backgr...
...create a custom Chartink scanner designed specifically for equities. It should provide real-time and historical data analysis capabilities. Key Requirements: - Equities Focus: The tool should be optimized for stocks and securities. - Real-time Data Analysis: I need to stay on top of market movements as they happen. - Historical Data Analysis: Analyzing past data is crucial for spotting trends and making informed decisions. - Potential Stock Trends: The tool should help me identify potential trends in the equities market. - Trading Opportunities: I want to be able to use the output to identify profitable trading opportunities. It's important that the tool is user-friendly, efficient, and reliable. Experience in developing financial tools or trading platforms is highl...
...and UI/UX design. Key responsibilities: - Crafting new designs from scratch: You must have a strong understanding of current design trends and best practices, and the ability to create fresh, original designs that align with our brand's identity. - Updating existing designs: You will also be responsible for enhancing and refreshing our current designs to ensure consistency and relevance in the market. I am looking for a team that can accommodate the following: - Daily deliverables: We anticipate requiring new designs on a daily basis, hence your team must be able to commit to this frequency. - High quality work: Our expectations are high, and we need a team with a proven track record of delivering excellent design work, both in terms of aesthetics and functionality. Idea...
I'm looking for a skilled developer who can work with Angular, Node.js, C#, and C++. Unfortunately, I missed answering the question about the project's nature and main goal, but here's an overview of what I need: - You'll be working on a software project that involves these technologies. - Your tasks may include front-end and back-end development, and potentially some native app development. - You must be proficient in all these languages/technologies. Please reach out with your experience in these technologies and a brief overview of any similar projects you've worked on.
... and running shoes. The key feature of this project is the comfort of the designed shoes. Their target market is children hence, any past experience or general understanding of children’s preferences regarding comfort would be ideal. Key Responsibilities: - Design comfortable sneakers, casual shoes, sports, and running shoes tailored for children. - Ensure designs align with the understanding of what children need and prefer for maximum comfort. Required Skills: - Proven experience in designing children's footwear. - Strong understanding of children's footwear ergonomics. - Excellent knowledge of durability and aesthetic trends in children's footwear. - Ability to use design software. I will provide additional details about the project upon selec...
...resonate with the business values and capture the brand essence. Key Points: - The logo should be illustrative in style, potentially incorporating a visual element that represents the business. - I'm open to exploring different color schemes, with a preference for a mix of black and white, blue and white, and green and white. - The selected freelancer will need to have a good understanding of the market and should be able to deliver a design that stands out in the industry. - Experience with logo design for established businesses is a plus. Please provide samples of your previous work that showcase your skills in this area. - The design should be unique, modern, and memorable. - The selected freelancer will need to be responsive to feedback and able to make revisio...
