Vb net cloud database punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I'm looking for a skilled developer to create a business website, and I'm open to using either PHP or .NET. Key requirements for this project include: - Implementation of a robust and user-friendly payment gateway integration for seamless transactions. - Integration of a feature that allows businesses to list their business for sale listing on the site. Your experience with development and payment integration will be crucial. Please share relevant experience and approaches in your proposal.
AWS to New cloud server migration-Django & Reactjs Server setup Code migration and setup SSL certificate - 1-year plan 50 /year
I'm looking for a Kotlin developer with experience in migrating applications from local Realm to MongoDB Realm. The current status of the app is fully developed, and I'm only interested in converting the local Realm database to the MongoDB Realm database, without any additional feature or minor changes. The ideal candidate should: - Be proficient in Kotlin - Have experience with Realm - Have experience with MongoDB Realm - Understand database migration processes and best practices
I'm seeking a creative and experienced menu designer to help craft a visually appealing and informative menu for my Indian cuisine cloud kitchen. As our primary audience is families, the design should be family-friendly and welcoming. Ideal skills & experience: - Proven experience in menu design preferably with a focus on the food and restaurant industry. - Understanding of Indian culture and cuisine. - Excellent writing skills, able to succinctly describe dishes. The task at hand includes: - Designing a menu that is visually appealing and aligns with our brand identity. - Writing brief descriptions for each dish in a way that entices, yet remains clear and concise. - Collaborating with me for revisions until the final output is satisfactory. Maintaining attention to cul...
Training for model deployment, training and fine tuning. Agenda for training session - Quick intro (concept, process, procedures and tools) - Environment requirements and setup - Installing / deploying a model (local and cloud) - Training a model (prerequisites included) - Fine tuning a model - Running ML Model with API - Q & A
I'm looking for an experienced freelancer to tackle data entry. The focus is on text data, which needs to be accurately inputted into a structured database. While attention to detail is important, issues checking for spelling or grammar errors will not form part of the job scope. In line with this, the ideal candidate should: - Have a proven track record with data entry projects - Have expertise in structured databases - Be able to work accurately with text data - Have the ability to complete tasks effectively within the given timeline.
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
I am looking for a database website that serves as a customer form. This form will be used by customers to fill in various fields. Upon submitting the form, they will automatically receive a comprehensive response based on the information they provided. Key Requirements: - The customer form should include fields for Name, Contact information, Address, Location, Product or Service details, Width and Height, Dimensions, and Vertical or Horizontal preference. - The form should have an inbuilt auto-calculation feature that computes the Total cost, based on the area calculated, and any additional amount based on the customer's requirements. Delivery of Reverted Information: - The system should trigger an automated response to the customer. This can be in the form of an Email, a We...
...principles and best practices for creating intuitive and user-friendly interfaces. Experience with prototyping tools like Sketch, Adobe XD, or Figma for designing app layouts, user flows, and interactions. 6. Server Infrastructure and Scalability: Ability to design and implement scalable server architecture to handle a large number of concurrent users and requests. Experience with cloud computing platforms like AWS, Google Cloud, or Azure for deploying and managing server infrastructure. 7. Security and Compliance: Knowledge of security best practices for protecting user data, including encryption, authentication, and authorization. Understanding of relevant regulations and compliance standards related to data privacy and security, such as GDPR or HIPAA. 8. Project Mana...
...reminders. - Prescription Management: I also need the system to manage prescriptions for patients, including tracking medication, dosage, and instructions. System Preferences: - Cloud-Based: I prefer a cloud-based system for storing research laboratory results and patient consents. This will allow for easy access and sharing of data. - Role-Based Access Control: The cloud-based system must implement role-based access control. This is crucial for ensuring that only authorized personnel can access and modify sensitive information. Ideal Skills: - Experience in developing healthcare information systems. - Proficiency in cloud-based system development. - Strong understanding of role-based access control. - Blockchain sandbox is available If you are confident ...
I'm in need of an experienced .Net developer, with solid skills in MSSQL and C#, who can effectively handle front-end development tasks in my POS terminal project. Your primary tasks will be: - Implement business logic based on defined user stories. - Develop the user interface of the POS terminal using C# and associated .NET technologies. - Integrate the POS terminal with MSSQL database for data storage and management Ideal skills and experience: - Proficiency in .Net, MSSQL, and C#. - Previous experience in front-end development. This role requires both technical expertise and keen attention to detail. I am looking forward to your innovative solutions to meet our project requirements.
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
I'm requiring an experienced deployment specialist for Odoo 17 on Google Cloud. As a company owner, I possess an active Google Cloud account hence you won't need to facilitate that. For the database system, we'd like to incorporate MySQL, necessitating a strong knowledge in this area. Key skills needed: - Familiarity with Odoo 17 - Expertise in Google Cloud operations - Proficiency in MySQL configurations Cease this opportunity to work on a highly professional project and bolster your profile.
I have a database that I need to be cleaned up. The main task is to remove duplicate entries. Key Points: - Main Task: The primary goal of the data cleaning project is to remove duplicate entries in the database. - Handling Duplicates: The duplicates should be automatically deleted, not merged or manually reviewed. Ideal Skills & Experience: - Database Management: A strong background in database management is crucial for this task to ensure the data is processed correctly without compromising the database integrity. - Data Cleaning: Experience with data cleaning processes, especially in handling duplicate records, is important. - Automation: The ability to automate the deletion of the duplicates efficiently and accurately is essential. Please bid...
We ...knowledge of facial recognition and facial expression with AI or machine learning. A passion for learning and staying updated with emerging technologies. If you are a skilled Android/Flutter developer with a passion for AI and are excited about working on innovative projects, we would love to hear from you. Please submit your resume and portfolio showcasing your relevant experience. Features: Cloud-Based AI Services: Reinforcement Learning: Speech Recognition and Synthesis Computer Vision Natural Language Processing (NLP) Neural Networks: Machine Learning (ML) Libraries This is a great opportunity to be part of an innovative project that pushes the boundaries of what AI can do in the realm of user entertainment. Looking forward to discussing this project with qualified fr...
I am in need of an experienced full stack developer who is well-versed in .NET and Angular to assist with the backend and frontend development of my project. Essential Tasks: - Involvement in both backend and frontend development processes - Providing valuable insights during project reviews Key Skills: - Strong competence in .NET and Angular - Proven experience in full stack development - A strong grasp of cloud technologies is advantageous - Excellent communication skills, as understanding and following project requirements are crucial Project Timeline: - There is no strict time frame for completion of this project. We value quality deliverability and careful attention to detail above speed. Ideally, you have a portfolio of previous projects to demonstrate y...
I'm seeking a skilled developer with expertise in .NET and Angular to take part in my ongoing web development projects. The main goal of the project is to enhance an existing application. Requirements: - Proficiency in .NET for backend development - Strong experience with Angular for frontend development - Excellent understanding of SQL Server and MongoDB databases - Previous work with DevExpress is essential Your responsibilities will include: - Developing APIs using .NET for enhancing the application - Integrating Angular for improving the frontend - Ensuring seamless operation with SQL Server and potentially MongoDB Ideal candidates should have a strong understanding of web development and be able to contribute effectively to enhancing the current state o...
I urgently require a thorough cleanup of my contact database. The main tasks include: - Verification of the correctness of email addresses - Authenticity check of RUTs - Verification of phone numbers The right candidate for this project should possess excellent attention to detail and experience in database management, particularly in contact cleaning. Familiarity with RUT verification will be highly valued. Please apply only if you can start immediately.
I'm looking for a skilled developer who can enhance the WhatsApp Cloud API to enable the sending of disappearing media (One-time view) with customizable expiration times and auto-deletion after viewing. This project is on an urgent timeline and will involve integration into both iOS and Android platforms. Key requirements: - Modification of WhatsApp Cloud API functionalities to allow for sending one-time view media. - Implementing a feature that allows the sender to set a customizable expiration time for media sent. - Ensuring that the sent media gets automatically deleted after it has been viewed. Your role will be to: - Understand the current functionality and limitations of WhatsApp Cloud API. - Develop custom solutions to enable one-time view media. - Imple...
I'm in need of an expert to optimize my WordPress database speed. The current issues I'm facing involve slow loading times and prolonged database queries. The following tasks are essential for fixing the site's speed: - Updating and optimizing plugins: The site is currently slowed down by outdated plugins. An experienced professional should be able to update and optimize these plugins to enhance the site's performance. - Database performance improvement: As my priority lies in improving database performance, the freelancer should focus on database queries and other related optimizations to ensure the site runs smoothly and efficiently. - Site speed score: The ultimate goal is to achieve a site speed score above 95. The hired individua...
I need a Terraform script that can provision a compute instance in Oracle Cloud Infrastructure (OCI), and automatically mount volumes to my desired mount points using user_data. The key requirements for this project are: - Creation of a compute instance on Oracle Cloud Infrastructure - Proper mounting of volumes to specific mount points - The mounting of the volumes should be done using user_data Ideal Skillset: - Proficient in Terraform scripting - Extensive experience working with Oracle Cloud Infrastructure - Strong understanding of volume mounting and user_data configuration - Knowledge of best practices for cloud provisioning and automation Please note that this project is specifically for Oracle Cloud Infrastructure, and bidders should have prior...
I want to change jobs and I am looking for specific positions that match my profile. Due to my current engagements, I don't have enough time to research all HR job posts on the net, so I am looking for a skillful Recruitment Specialist and HR Generalist. The main sources of info would be LinkedIn and Indeed and other job platforms - we will discuss. My requirements for the position are very specific. I have a LinkedIn profile. I research myself too, but I feel I don't put enough time. The task is to find jobs posts matching my profile and the requirements that I will provide, and to input all the results in a spreadsheet. Work time: once a week for about 2 hours, or twice a week for about 1 hour. Required Skills: - Prior experience in HR or recruitment - Much experi...
Create an experience cloud site. Create one dynamic reusable search component in site it should be visible to the the user A but should be hidden to the user B. If we will get 50000 records how to optimize solutions .
I'm looking for an experienced DevOps engineer who can handle the tasks of continuous integration and deployment for my Python-based project. Key Responsibilities: - Implementing...deployment process - Suggesting and implementing best practices for CI/CD in Python projects The ideal candidate should have: - Proven experience in implementing CI/CD pipelines for Python projects - Strong understanding of infrastructure as code and automation - Proficiency in tools like Jenkins, GitLab CI, or similar - Good knowledge of containerization technologies like Docker - Familiarity with cloud platforms like AWS or GCP - Ability to troubleshoot and optimize performance issues in the deployment process. Please respond with your relevant experience and successful projects you have handl...
I'm currently encountering connectivity issues with my existing Azure Virtual Networks specifically with connecting to the MySQL database. I have a main Vnet with my mysql database in there. I have a virtual machine in there too which can connect to the database I have a second vnet which is peered to the main vnet. I have a virtual machine in this vnet too. It can talk to the virtual machine in the main vnet, but cannot connect to the database. I need it to be able to, and I cannot figure out why. You can tell me how to do it and I can test, this doesn’t need to be a long project!
Hi, Job Title: Senior Developer - SQL Se...business intelligence and data analytics requirements. Tasks involve creating data models and developing multidimensional cubes. Key skills required: expertise in MS SQL Server Analysis Services (SSAS) Tabular and Multidimensional. Proficiency in TSQL for writing performant queries is essential. Experience with data visualization and reporting tools is highly valued. Additional knowledge of Excel and .Net development is advantageous. Strong problem-solving abilities, excellent communication skills, and a collaborative mindset are desired traits. Developer has to be at the ON SITE Dubai office. - Work Location - Dubai - Number of Working Days - 6 days ( Monday to Friday ) - Number of Working Hours - 10hrs per day - N...
I need an expert to help with advanced troubleshooting and optimization for my Oracle database. The ideal candidate should have: - Proven experience in database administration. - Proficiency in Oracle database. - Expertise in database troubleshooting and performance optimization. - Adept in using SQL Developer for managing database tasks. You'll be handling tasks such as: - Identifying and resolving performance issues. - Suggesting and implementing optimizations. - Monitoring database activities to ensure smooth operations. Your role will be crucial in ensuring the efficiency and security of our Oracle database.
...and assess the images for quality. In the past I've used but this isn't the most accurate method. Sometimes it will miss images that are extremely pixelated and blurry, or filter out good images by mistake. I'm not sure if I should be using something like Amazon Rekognition, Google Cloud Vision, or Microsoft Azure instead? Or if I can save money and still get good results with a local option like OpenCV? I guess it depends on speed and accuracy. 2) I'd also like to be able to scan images in bulk and detect any text. Same question as far as whether or not I can save money by doing this accurately with OpenCV or something else? Or if I should be using one of the other providers
I am looking to find someone with Sage 200 on premise knowledge to find out how to connect to the API. I have the api_status url working but cannot find what the url should be for the API calls. The documentation seems to be for the cloud connection not a on premise setup. So looking for someone who has done that before to give a hand. Need someone with knowledge on Sage 200 API setup on premise.
...Implement A Wide Range Of Integration Scenarios Using The Dell Boomi Platform, Including Service-Oriented Architecture (SOA), REST, And Messaging Platforms. 4. Ensure The Security Of Enterprise Applications Within The Context Of API And Messaging Integrations. 5. Design And Implement Microservices-Based Application And Integration Architectures To Support Scalability And Flexibility. 6. Manage Cloud And On-Premises Deployments, Ensuring Smooth Transitions And Operations. 7. Obtain And Maintain Multiple Certifications In Dell Boomi To Stay Abreast Of The Latest Advancements. 8. Collaborate Closely With Client Resources To Manage The Transition From the Design And Prototype Phase To the Development And Build Phase. 9. Monitor Integration Projects To Ensure They Meet Business Requir...
I am in search of a proficient developer having in-depth knowledge of Java, Angular, React, and AWS. Your expertise will be utilized for developing a robust project from scratch. Key Responsibilities: - Write clean, high-quality, high-performance, maintainable code - Develop and support software including applications, database integration, interfaces, and new functionality enhancements - Maintain and improve the performance of existing software Key Skills and Experience: - Extensive experience with Java, Angular, React programming - Knowledge of Spring Boot framework - Familiarity with deploying projects on AWS - Strong debugging and problem-solving skills This is a demanding yet rewarding project, and your dedication will be highly valued. Looking forward to working with a t...
I am seeking the developer with advanced skills in API implementation, with specific experience with the BnP Paribas' API structure, as well as a strong proficiency in C# .NET. Project duration 3 months. Spoken language Greek. Key Responsibilities: - Establish a robust connection between our application and the BnP Paribas via their API. - Ensure successful transmission of specific data, Cash Account Info, Securities Account Holdings, Settlement Status, Transactional – FX.. Required Experience: - Strong proficiency in C# .NET - Proven experience in API Integration, preferably with BnP Paribas - Knowledge of JSON data format - Proven ability to work according to specifications and deadlines - Ability to test and troubleshoot the integration This project involves...
I am in need of a skilled data entry operator to assist with the transfer of input of text data. Your main task is to take text data from an online database and accurately enter it into an Excel spreadsheet. Requirements: - Ability to accurately enter text data - Proficient in Excel - Experience sourcing data from online databases - Diligent and detail-oriented to ensure no errors are made during data transfer - Strong English language skills to ensure effective communication The ideal freelancer for this project is someone with proven data entry experience, excellent Excel skills, and vast familiarity with online databases. Being a detail-oriented person with great concentration skills will be a huge plus.
...seeking a skilled developer to create a web application using .NET Core. This role involves a primary focus on building a robust, user-friendly web app. Ideal Skills and Experience: - Proficiency in .NET Core - Previous experience with web application development - Understanding of best practices in software design - Familiarity with integrating Payment Gateway APIs - Strong problem-solving and communication skills Key Deliverables: 1. Develop a web application using .NET Core that meets our specifications and requirements. 2. Implement Payment Gateway integration within the application for seamless transactions. 3. Ensure the web application is optimized for performance and is secure. If you have a proven track record in building .NET Core web applicatio...
I am seeking a developer with fullstack capabilities to create an e-commerce website for my business. The system will require: - User Registration and Login: Visitors should be able to create accounts and sign in to access their personal information and history. - E-commerce Capabilities: The platform will host between 50 to 200 products. Each product will need to have its own page with detailed descriptions, pricing, and an option to add to cart. - Content Management System: I will need to be able to easily update product listings, add new items, and manage orders. The ideal candidate for this project should have: - Previous experience with fullstack web development, especially on e-commerce platforms. - Proficiency in modern web technologies and frameworks. - A strong understanding of ...
I'm currently in need of assistance configuring the email sending events on Amazon SES. I aim to send emails from multiple domains. Key Tasks Involved: - Configuring email sending events like (opens,clicks) on campaigns, domains, configurations sets levels. Either directly from Amazon ses api or cloud-watch. Ideal skills and experience: - Previous experience with Amazon SES and cloudwatch. - Strong knowledge in AWS, specifically the SES service - Excellent problem-solving abilities,.
...application onto the AWS cloud. The project involves: - Hosting the existing Java-based desktop application on an AWS cloud instance. - Implementing a multi-user access system. - Integrating a MySQL database component. - Developing a Python-based web interface for users to change settings. The ideal candidate should have: - Proficiency in Java, Python, and MySQL. - Prior experience with cloud hosting, particularly on AWS. - Knowledge of user access control systems, particularly Discretionary Access Control. - A good understanding of desktop-to-cloud migration. - Strong communication skills and attention to detail. We need a developer who can take a Java based desktop application and host it on a cloud instant of AWS. - must have multi us...
I need a seasoned ASP.NET VB developer with a strong background in updating existing applications. You will be responsible for enhancing and improving the functionality of our current system. Ideal Skills and Experience: - Proven experience with ASP.NET VB - Competence in updating and maintaining existing applications - Strong problem-solving skills - Excellent communication and teamwork abilities Your application should clearly demonstrate your experience with updating existing ASP.NET VB applications. Please don't hesitate to include links to relevant past work.
I am in need of a seasoned Full Stack Developer, confident in using both Flutter and React Native platforms, to assist in the creation of multiple mobile cloud-native applications. Most likely, these applications will lean towards the e-commerce sector. Having no distinct design ideas as yet - I will need full assistance in app design, so your input will be crucial. Key Competencies: - Expertise in Flutter and React Native for app development - Strong skills in cloud-native applications - Ability to develop compelling e-commerce applications - Proficient in helping define and refine app design guidelines Your creative ability and technical excellence are vital for this project. The successful bid will demonstrate both these attributes, coupled with impressive experienc...
...Oracle 19c database through JDBC. The primary goal of this project is to incorporate essential data operations into the application, mainly including reading, writing, and updating data in the database. Key Responsibilities: - Establishing a secure connection to an Oracle 19c database using JDBC. - Implementing CRUD operations (Create, Read, Update, Delete) features within the application. - Ensuring the application is optimized for efficient data handling and processing. Security Requirement: - The application must be able to securely access the database using username/password authentication. Ideal Candidate: - Proficient in Java and Springboot framework development. - Experienced with Oracle database SQL and JDBC connectivity. - Prior experience...
I'm looking for a skilled developer to create a C# web application. Key Requirements: - Fluency in C# programming language - Proficiency in web application development - Experience with .NET Core, Xamarin, or Unity frameworks is a plus - Familiarity with web application technologies and best practices It's a plus if you have prior experience in building web applications, but not necessary. The most important aspect is your ability to understand and implement the project requirements effectively. A good grasp of C# and web programming is a must.
I'm seeking an experienced Firebase & Google Cloud developer to help with various aspects of my project. Key Responsibilities: - Implementing user authentication and authorization - Setting up and integrating a database - Developing cloud functions and serverless architecture I require someone with expertise in both frontend and backend development, as my project is intended to support both web and mobile applications. Ideal Skills: - Extensive experience with Firebase and Google Cloud - Proficient in both frontend and backend development - Prior experience with user authentication and authorization - Capable of database setup and integration - Knowledge of cloud functions and serverless architecture Your contribution will be cruc...
I am looking for Individual to Create a static website for my cloud based pathology lab management software. i have every thing domain, Hosting, Stock Photos and graphics are Provided by us. your job is : 1. Create a code for a Responsive multipage website using PHP, HTML, CSS (4 page Home, About software, About us, contact ) 2. Create editable header, footer and menu for easy editing. 3.. Content writing and arrange the things together. 4. SEO Key word (to Prove your skill in SEO) we have this awesome trample too if you're good on edit
I have a Kotlin Multi Platform (KMP) app that uses Realm as the local database. I need that ported to use the web (MongoDB Atlas) . The app is 100% functional for a local database and just needs ported only. Nothing additional is needed. I will provide the information needed to access Atlas (Realm for the cloud). There are a total of four Realm classes that will need to be ported. All of the Kotlin code is in one class, the class. Some of the porting has already been started. - The app should be designed using KMP, targeting Android 12 and above. - The app should strictly adhere to a realm project structure for data management. - The app should support cloud storage for data using AtlasDB