Vb net hospital management punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
...spoken everyday. Availability: ASAP Main responsibilities: The ideal candidate is expected to carry out the following duties both in Russian language: Sales: first point of contact for advices and general enquiries from prospects: what products to buy, prices, offers, quotations, advises on design, colours, sizes, expected delivery times, guarantees, sales policies, etc… Order management: checking clients’ artwork, verifying colours, making graphic files quick fixes and modifications using Photoshop, coordination for the manufacturing and approval of samples Post sales support: helping customers solving problems with deliveries, tracking parcels online (EestiPost, Omniva, DPD, TNT, FedEx, UPS, etc…) handling issues reported by clients with p...
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
nhjkmbjkgugyufyufykjkhiu kiuy7yubnbjhggggghutyurrtr lbhrffyyffdfhbjjhgyfgjkgggnjhjvdrtstghjgszzxfvhjjhgjhjjsrdfjpooouiuyui
nhjkmbjkgugyufyufykjkhiu kiuy7yubnbjhggggghutyurrtr lbhrffyyffdfhbjjhgyfgjkgggnjhjvdrtstghjgszzxfvhjjhgjhjjsrdfjpooouiuyui
...group specifically targeting local community members in the United States. Key Responsibilities: - Implementing strategies to increase the group's membership - Engaging with the audience and fostering a sense of community - Delivering a regular flow of content that is relevant to the local community I'm specifically interested in a freelancer who: - Has a solid background in social media management and growth - Possesses experience in creating and curating engaging content - Understands the nuances of community building on Facebook Ideal Deliverables: - A noticeable increase in the group's membership within a specified timeframe - A boost in the group's engagement levels - Consistent and relevant content delivery Previous experience in growing Facebook ...
I'm seeking an experienced WordPress developer to craft an e-commerce website primarily using Easy Digital Downloads. Here's what I'm looking for: - Create an intuitive and seamless e-commerce experience. - Integrate Easy Digital Downloads as the core marketplace plugin. - Set up multiple Indian payment gateways, such as Net Banking, BHIM, GPay, and Phone Pay, ensuring security and ease of use. - Optimize site for performance, scalability, and SEO. Ideal Skills: - Proficiency in WordPress & Easy Digital Downloads - Experience with payment gateway integration - Strong portfolio with e-commerce examples - SEO and performance optimization expertise The successful freelancer will demonstrate a strong understanding of e-commerce strategies, particularly within the W...
I need an experienced social media manager to take over the content creation and posting for a number of clients. - **Content Creation**: I currently have a mix of text-based and image-based posts. You will be responsible for creating similar design content. - **Posting Schedule**: I need 4 posts a week on bo...mix of text-based and image-based posts. You will be responsible for creating similar design content. - **Posting Schedule**: I need 4 posts a week on both Facebook and Instagram for each client. - **Audience**: No specific target audience to focus on. This will be an ongoing project, progressively starting with 6 clients. The ideal candidate should have a solid understanding of social media management, excellent design skills, and be able to consistently deliver engagin...
...integrate a few new suppliers via their API so we need new functionalities added to the plugin. -woocommerce plugin FIX - linux management - deploy on linux, create new features - long term maintenance Gitlab version control - create pipeline to our staging server and do version control RESPONSIBILITIES: - Integration of new B2B APIs - New payment gateway integration - - Implementation of bug fixes and performance improvements. - Regular software updates and security patches. - Feature additions and enhancements. Skills and Experience: - Proven experience in maintaining e-commerce solutions. - Ability to work independently and meet deadlines. - .NET and are a plus but not a requirement. Prerequisites: For the long term project the *STARTING* wage will be as stated
I'm seeking a beginner level IT Technical Trainer with expertise in Networking, Operating Systems Trouble Shooting, and MDM. The candidate I'm looking for should have: - Solid foundation in Networking - Knowledge of MDM (Mobile Device Management) - Ability to troubleshoot various operating systems The mode of training delivery preferred is in-person at our location. Therefore, local candidates or those willing to commute will be ideal.
I'm seeking a social media manager to help me with my Facebook and Instagram accounts. Key Responsibilities: - Grow my follower count on Facebook and Instagram - Enhance engagement on both platforms - Drive traffic...with my Facebook and Instagram accounts. Key Responsibilities: - Grow my follower count on Facebook and Instagram - Enhance engagement on both platforms - Drive traffic to my website from these social media channels I'm looking to: - Increase the number of followers - Boost engagement levels - Drive quality traffic to my website The ideal candidate should have experience in: - Social media management - Growing followers and engagement - Increasing website traffic through social media Your successful work on this project will be a great step towards long...
...dashboard. The primary goal of this project is to provide a user-friendly interface for my data, with the following features in mind: - **Data Visualization**: I want the dashboard to be able to display key data pertinent to my business. This may include sales data, user activity, and website traffic. - **User Management**: While not explicitly stated, I understand the importance of user management in an admin dashboard. Therefore, building a system that allows for user management is a crucial part of this project. - **Role-based Access Control**: I want the dashboard to have role-based access control. This means that users will have different levels of access based on their roles within the organization. Your responsibilities will include the following: - **Data ...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
I'm seeking a skilled professional to design and build an AIS 140 standard GPS device with a primary focus on fleet management. The device will need to have the following features: - Real-time tracking: It should be able to provide up-to-date location information and movement status of the vehicles. - Geo-fencing: The device should support the creation of virtual geographic boundaries, and alert the control center when the vehicles breach these boundaries. - Fuel monitoring: It should be equipped with technology to monitor fuel levels in real-time, allowing for efficient fuel management. The device should support the following communication interfaces: - 4G/LTE: To ensure stable and fast connection for data transfer. - Bluetooth: To allow for wireless communication with...
As an innovative company, we're in need of a dotnet expert who will focus on improving our MSSQL database...who will focus on improving our MSSQL database. Your tasks will include: - Safely migrating data from one source to another - Optimizing our MSSQL database for enhanced performance For the successful execution of these tasks, we expect you to have extensive experience with dotnet and MSSQL databases. In particular, we value the following skills: - Proficiency in using dotnet for database management - Hands-on experience in data migration strategies - Expertise in database optimization techniques We're looking forward to working with a problem solver who can effectively boost the performance of our MSSQL database through optimization and ensure seamless data ...
I'm looking for a competent developer to create a Multi Vendor Ecommerce Auction Marketplace on Shopify. The project involves integrating the Shopify platform with a 3rd party platform's API, specifically GAP (documetation to be provided). Key Project Details: - Development of a Multi Vendor Ecommerce platform on Shopify - Implementation of Auction functionality - Ensuring seamless integration with a 3rd party platform (ATG) through its API - Strong reporting features to easily export to Xero - Built Modular - App with push notifications Ideal Skills and Experience: - Previous experience in developing and launching Ecommerce Auction Marketplaces, preferably on Shopify - Profound understanding and experience with Shopify platform and API integrations - Proven track record of int...
Our laboratory management application, currently built with french, requires enhanced communication capabilities with Data Management Systems specifically for real-time data synchronization. Key requirements: - Facilitate seamless, real-time data exchange between our laboratory management application and the Data Management Systems. - Ensure data integrity and reliability throughout the synchronization process. Ideal skills and experience: - Proficiency in the programming languages French is built with to ensure seamless integration with the existing application. - Proven experience in developing real-time data synchronization mechanisms. - Strong understanding of data management systems to facilitate efficient communication and synchronization. - Abil...
...with experience in translating complex medical concepts into Turkish for my pain management clinic's website. Key Requirements: - Specialization: The copywriter should have extensive experience in medical copywriting, preferably in the area of joint pain management. - Patient Testimonials: The website should include real patient testimonials, so the copywriter should be skilled in incorporating these into the overall content. - Language Level: The content should be highly technical to cater to medical professionals, ensuring a precise and accurate representation of our clinic and services. Your role will be crucial in helping us connect with our Turkish-speaking audience. A deep understanding of pain management and medical terminology is essential, as is the...
...final desired outcome. The full details will be explained in further discussions. We will need the installation and testing of the solution and ongoing support and consulting after implementation. Please note, we are specifically looking for a technical expert in handling Haraka/Postal/SMTP. This is NOT a project focused on email delivery as it is applied to marketing type emails and reputation management. This is specifically a very technical project. Please only respond to this job posting if you fit the above description and have this knowledge and experience. If you do respond please mention any projects you have worked on which required this kind of knowledge and level of expertise. Before we can discuss the project in full you will have to sign an NDA. If that is a prob...
We are looking for a computer program that can take over some of the repetitive tasks we currently do manually. The program wil...be used on Windows OS and should be capable of performing the following functions: - Automating data entry tasks - Organizing files efficiently - Managing emails effectively - Checking invoices to prevent double billing Ideal candidates for this project should have: - Experience in developing Windows-based automation software - A strong understanding of data entry, file organization, email management, and invoice checking processes - Proficiency in designing user-friendly interfaces - Ability to integrate error prevention mechanisms to ensure accuracy Your solution should help us streamline our work processes, reduce human error, and increase overall e...
...developer who can handle two main tasks: integrating e-commerce functionality and creating a custom, modern, minimalist theme. Key Deliverables: - E-commerce Integration: This will involve setting up a seamless online shopping experience for customers. The ideal candidate will be adept at integrating popular e-commerce plugins like WooCommerce or Shopify, ensuring easy product browsing, cart management, and secure payment processing. - Custom Theme Development: The website's design should be tailored to fit a modern and minimalist style. The selected freelancer should be capable of creating a unique, visually appealing theme that reflects this aesthetic. Given that the main purpose of this website is to display information and a portfolio, the design should be clean, ...
...showcases the simplicity and functionality of the platform, specifically focusing on our Agency feature (we’ll create account for designer). The video should highlight how easy it is to create and manage multiple accounts, demonstrating the process of account creation, duplication, and management. Objectives: To illustrate the ease of use and efficiency of for agencies. To demonstrate key features such as account creation, account duplication, and seamless account management. To encourage agencies to sign up for by showcasing its comprehensive toolset. Video Specifications: Length: Approx. 2 minutes Format: High-definition quality, suitable for both web & social media platforms and mobile viewing. Style: Modern, professional, with a direct focus on walkthro...
...Strato. The key tasks required are: - Recovery: I need help with server recovery, the ability to troubleshoot and restore the server in case of failure. - Update: Keeping the server software up-to-date is crucial for security and compatibility. I need a specialist to handle the server updates effectively. Ideal skills for this job include: - Strong expertise in Linux server administration and management. - Proven experience with server recovery procedures. - Proficiency in updating server software without causing disruptions. - Strato dedicated server recovery - Operating system Ubuntu 16.04 LTS 64bit + Plesk Onyx (unsupported) - Ubuntu is outdated therefore weI cant login to the server - Execute : no hard reboot , no result - Executed : Recovery system: Rescue 64bit 4.x-Kerne...
I'm seeking a JIRA expert with a proven track record in configuring JIRA projects in SCRUM, Project Management, and KANBAN formats. The ideal candidate will be able to implement specific features and functionalities within these projects. Key responsibilities include: - Implementing user story management, sprint planning, task tracking, burndown charts, release management, and Kanban boards for SCRUM, Project Management, and KANBAN projects. - Ensuring that each project is tailored to the specific needs and workflows of my team. - Enhancing our project planning and tracking processes. I'm looking for a professional who can ensure that the integration of JIRA into our workflow is seamless, efficient, and user-friendly. The ultimate goal of this projec...
I'm in need of a professional who can confidently and effectively publish and promote my skills in IT. - The key skills I want to highlight are my forte in strategic marketing and computer science. - I'm particularly seeking someone with a proven track record in online advertising and social media management - an area I wish to showcase prominently on my profile. - Experienced professionals in the field of marketing and IT are most welcome to bid. - The ideal candidate will also have hands-on experience in creating attention-grabbing, comprehensive professional profiles. Looking forward to your proposals!
I'm seeking a skilled MikroTik developer with expertise in RouterOS customization, specifically firewall configurations. Key tasks will include: - Customizing existing firewall settings - Comprehensive integration with PMS (Property Management Systems) The ideal candidate has prior experience in network and firewall configuration, along with a robust understanding of MikroTik RouterOS. Proficiency in PMS integration is also a prerequisite for this project. Dialogue will be necessary throughout the project to ensure clarity and precision in meeting the project's objectives.
...visually appealing, but also easy to manage in terms of adding new products, categories, and descriptions. Additionally, I'd like the freelancer to promote the site through various online channels to increase its visibility and drive traffic and conversions. Key Points: - Development of an E-commerce website - Tailoring the design and layout for UAE market - A well-structured backend for easy management - Implementation of SEO to boost search engine rankings - Setting up Google AdSense for ad monetization Marketing: - Promoting the website on Facebook, Instagram, and Twitter - Crafting engaging content for social media posts - Running targeted ads to reach potential customers - Implementing effective SEO strategies to improve website's visibility The products I pla...
...content and marketing plan. Responsibilities: -Content Creation and Management: -Develop and schedule daily posts for Instagram, TikTok, and Twitter. -Write weekly blog posts and newsletters. -Manage and create content for our YouTube channel, including weekly AMA (Ask Me Anything) sessions. Event Coordination: -Assist in organizing and promoting monthly influencer events -Engagement and Community Building: -Engage with followers and respond to comments and messages. -Organize and manage giveaways for followers Research and Analysis: -Conduct research on digital beauty trends and skincare ingredients. -Monitor and report on social media analytics to measure the impact and adjust strategies accordingly. -Shopify Management: -Update and manage product listings on Shopify....
I require an experienced web developer to build an e-learning web application. The primary audience will be college students. Key Features: - User authentication for security - Course management system for curriculum organization - Progress tracking to monitor student development Learning Resources: - Videos and interactive exercises for active, engaging learning - Quizzes to assess understanding and retention. The ideal candidate will possess a proven track record in web development, specifically with e-learning platforms, and a deep understanding of user experience design for educational purposes.
We are seeking a skilled tech writer and content editor who can independently research and create content to support our business by writing Medium posts and creating marketing materials . Key Responsibilities 1. Edit and refine Medium posts to ensure they are engaging, informative, and S...appropriate images for the content. The Ideal Candidate: - Proficient in tech writing and editing. - Good understanding of on-premise and SaaS solutions. - Experience in editing blog posts and marketing materials. - Able to work closely with the marketing team and deliver high-quality, error-free text. Example Topics: - Can AI Really Boost Your Work Efficiency? - Tips for Cutting Office Management Costs - Feature Comparison Is Not All - Comparison of Product A and Product B (function an...
We are looking for a developer with a strong understanding of Ultimate Members, WooCommerce, Event Management, and Job Manager plugins, proficient in troubleshooting and enhancing WordPress-based websites. Tasks Include: • Fixing errors (e.g., missing error messages on content upload failures) • Developing new pages and forms • Enhancing the landing page • Optimizing website performance and security Must-Have Skills: - WordPress development and customizations - Experience with HTML, CSS, JavaScript, and PHP Strong problem-solving abilities Please send us your resume including the experiences you have. We are looking forward to meeting you.
I am in need of an imaginative and technically proficient after effects editor. The nature and style of the videos are not specified, so versatility and adaptability will be crucial in this role. I am ...anywhere from 1 to 3 minutes ( show is about 3 hours and can loop ) , highlighting the most important aspects in a creative and concise manner. Skills Required: - Superior knowledge in After Effects - Ability to adapt to different video styles - Command over text/caption placement, colour grading, filter application - Creative editing and ability to replace or remove elements - Exceptional time management for delivering within the desired length - Detail oriented, with reputable work ethic. Experience preferred, but not necessary if you can demonstrate an aptitude for the task...
Develop a whistleblowing management platform for Spanish companies to efficiently handle reports of misconduct, ensuring compliance with current regulations. The platform should manage reports as tasks within the organisation, with defined states, assigned responsibilities, and status updates for the reporter. Additionally, it should include a Business Intelligence (BI) panel with detailed statistics on generated and managed reports. User Interface (UI) Report Form: An intuitive interface for reporters to submit their reports anonymously or with personal details. Reporter Portal: Access for reporters to track the status of their report using a unique code. Task Management for Reports Task States: Each report should go through various states (e.g., Received, Under R...
...plans prior, during and after the event, - Continuously monitor safety compliance during the event. - Quality control - Auditing and monitoring - Document management - Policy and procedures implementation - Other events safety related matters Skills and Experience Required: - Proven experience in large scale event safety management. - Expert knowledge of various safety threats and first-hand experience in planning for and mitigating these issues at events. - Excellent crisis and crowd control management skills. - Relevant qualifications in safety and emergency management NEBOSH ICG as minimum - excellent communication management - experience in generating reports - advanced Microsoft skills particularly in (words, excel and power point) You...
I am seeking an expert in Philippines' payroll compliance for my small business with 1-50 employees. The ideal candidate will provide the following services: - Tax filing and management: This includes ensuring that all taxes are filed correctly and on time, as well as managing any tax-related issues that may arise. - Employee benefits management: This involves overseeing our employee benefits program, making sure it complies with all relevant laws and regulations. - Regulatory compliance consulting: You will assist us in maintaining compliance with the relevant laws and regulations in Philippines, ensuring that our payroll processes are up to standard. The consultant must have a deep understanding of Philippines' payroll laws and regulations, as well as experience...
Title: Procurement Management App Development Project Description: We are seeking a skilled freelancer to develop a Procurement Management App using PowerApps. This comprehensive app will streamline various aspects of procurement, including sales, purchases, offer comparison, offer creation, order recording, item creation, and purchase analysis. Offer Comparator: The app should allow users to upload supplier offers, compare them against existing database entries, and identify the best offers based on configurable conditions. It should facilitate easy data input from Excel and offer detailed comparisons, with the ability to export results to Excel. Offer Creator: The freelancer should create functionality for users to customize sales offers by selecting and modifying ...
I am in need of an expert in B2B lead generation to help me with a specific project. The task involves targeting a local area for potential angel and private investors for an H.M.O in the health sector. Key Job Requirements: - Identify and compile a list of 50-100 angel or private investors from the local area. - Investors...Requirements: - Identify and compile a list of 50-100 angel or private investors from the local area. - Investors must have a previous history of investing in the health sector. - Delivery of the leads in an Excel spreadsheet format. Ideal Candidate: - Proven experience in B2B lead generation. - Good knowledge of the health sector and investment trends. - Excellent research skills. - Proficient in data management and Excel. - Strong communication and negotiati...
I'm in need of a web-based multi SKU inventory software that primarily focuses on real-time inventory tracking. This software will be utilized by our warehouse staff to ensure products are correctly logged and easily retrievable. Key Features: - Real-time Inventory Tracking:...system is to keep a close eye on the stock levels. - User-Friendly Interface: The software should be intuitive and easy to use for our warehouse staff. Integration: The system should have the capability to integrate with our accounting software. This is essential for keeping our financial records accurate and up-to-date. Ideal Skills and Experience: - Proven experience in developing inventory management software. - Familiarity with real-time inventory tracking. - Ability to integrate software with acco...
I am on the hunt for a PR freelancer with demonstrated experience in the technology sector and a keen understanding of the interests and habits of young adults. Your main responsibi...Generating innovative PR ideas to capture the attention of this youthful demographic and keep our brand top of mind The ideal candidate will have: - Proven PR expertise, particularly in the technology space - An ability to resonate with young adults and understand the platforms they engage with - A creative and dynamic approach to PR - Skills in strategic planning, collaboration, and campaign management In sum, your ultimate goal will be to elevate our brand and ensure it resonates vividly within the minds of young adults. If you've got the skills and the vision to make this happen, I want to...
I need a skilled website developer to create a travel and tourism website using for the frontend and Node.js for the APIs. The prototype will be similar to the following websites: and Key Requirements: Frontend Development: Expertise in to build a responsive, user-fr...SAAS applications and connecting them with brokers through APIs. Design: - I already have a theme in mind. It is the "ghurbo theme" which is a combination of {client's description of the theme}. Deliverables: Fully functional travel and tourism website with frontend built in and backend in Node.js. Admin dashboard for content management and itinerary updates. Integration with broker APIs for seamless booking and package management.
...include: - A list of recent insider trading activities: This will help users stay updated on relevant market movements. - Filter options by date, company, or individual: Users should be able to narrow down information based on their interests easily. I have already made most of the scraper for this SEC insider trader tool and just need it fixed slightly and optimized. - For the database management of all data I have decided to go with PostgreSQL and have already set that all up Ideal skills and experience for this project: - Proficient in web development, specifically in creating forums and data-heavy pages. - Experience with financial websites or platforms. - Strong understanding of SEC regulations and how insider trading information is presented. - Ability to design with...
...server will be used for both voice calling and SMS messaging. Key Responsibilities: - Establishing a SIP trunk server with configurations optimized for Twilio - Implementing call management features like Call Recording, Call Forwarding, and Interactive Voice Response (IVR) - Ensuring seamless integration of both voice and SMS capabilities - Providing recommendations for server security and performance optimization Ideal Candidate: - Extensive experience with SIP trunking, particularly with Twilio - Proficiency in configuring and customizing SIP trunk servers - Proven track record in implementing call management features such as Call Recording, Call Forwarding, and IVR - Strong understanding of VoIP and telecommunication protocols - Familiarity with server security best ...
We're looking for a seasoned backend developer adept at working with the platform. Our project primarily involves rectifying some issues and implementi...features. The scope of work includes: - Implementing a seamless payment processing system. - Addressing some undisclosed issues. - Incorporating a solid user authentication system. - Optimizing the platform's performance. Prospective freelancers should possess proven experience in backend development, with solid understanding of different programming languages. Practical exposure to database management or mobile app development would be a plus, but is not a mandatory requirement. Prior experience with platform is a necessity. A prompt turnaround time and structured approach to problem-solving would be highly apprecia...
I'm seeking a knowledgeable Arduino and IoT expert...collecting data on water flow. Key functionalities required: - Pulse input data collection, specifically for monitoring water flow. - Understanding of Deep Sleep Mode to save Battery. - Data handling capabilities to efficiently send this information straight to the cloud system. The ideal freelancer for this project must demonstrate vast experience with Arduino programming, IoT systems, and data management. Familiarity with cloud technologies will be a significant plus. Ability to create a robust system capable of handling potential fluctuations in water flow is necessary. The chosen developer will be tasked with not just simple data gathering, but also with transferring these datasets to an online cloud repository for fu...
I'm seeking a Django and Python Fullstack developer who can lend their expertise to my application project. The chosen freelancer should excel in creating: - Robust user authentication and authorization systems -...Seamless database integration - Responsive design that adapt to various devices I have certain design ideas but I would highly appreciate guidance to help realize these concepts. The freelancer should possess a strong grasp of user-centric design and prove instrumental in translating these concepts into a streamlined, functional, and easy-to-use interface. Ideal skills: Python, Django, Database Management, User Interface Design, User Experience Design, and Responsive Web Design. It's a bonus if the candidate has a knack for making technical functionalities s...
...Production: 1. Develop and produce promotional content, including teasers, trailers, and ads, to effectively market and promote projects. 2. Collaborate with marketing and creative teams to align promotional materials with branding and campaign strategies. 3. Conceptualize and execute engaging promotional campaigns that capture the target audience's attention and drive engagement. Leadership and Team Management: 1. Manage a team of video editors, motion graphics artists, and post-production staff, delegating tasks, providing feedback, and fostering a collaborative and supportive work environment. 2. Mentor junior editors and provide training opportunities to enhance their technical skills, creative abilities, and professional development. Quality Assurance and Technical Ex...
I'm looking for Shopify experts who can help me set up a fully functional e-commerce website. Key ...planning to list around 1-50 products initially. - **Content Ready**: I have all the product images and descriptions ready, so you'll be responsible for integrating them into the site. Ideal Skills and Experience: - Proven experience in developing successful Shopify e-commerce websites. - Ability to create a visually appealing and user-friendly design. - Strong knowledge of product catalog management within Shopify. - Excellent proficiency in integrating product images and descriptions. - Good communication skills to ensure smooth collaboration throughout the project. If you're confident in your Shopify skills and have the availability to work on this project, I...
...following tasks on my existing server: - **Server Configuration:** Fine-tuning and optimizing my server settings to ensure it's running at its best. - **DNS Management:** Managing and configuring my domain's DNS settings to ensure proper functionality. - **Email Setup:** Setting up email services on the server for my domain. I will provide you with root access to the server, so you should be well-versed in security practices and able to handle the responsibilities that come with that level of access. Ideal candidates should have: - Extensive experience in managing Cpanel and WHM - Strong knowledge of DNS configuration and management - Proficiency in setting up email services - The ability to work with root level access securely and responsibly. Issue: Th...