Vb programs with coding and output punët
...monthly ongoing retainer or a per site cost but that is too difficult to gauge without actually speaking with you. Hello, I have my own little business creating and building brands for clients. I have been offering a 360 service including branding, graphics, websites, social media and top level conceptualisation of companies, services and products as a whole and seems to be going well but I am only one person and starting feel swamped. I am starting to think about trying to turn my business into an agency of sorts and am looking to extend my team and improve the quality of my service / output.l which in term would also allow me to start to take on a more overarching creative role and take on more clients. I’m n...
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I am looking for someone that can do coding and modify arcade cards please.
Want to extract a list of profiles including name, country, city, email, phone numbers, link to profile for a list of followers for total output should be around 100K profiles that will be used to feed meta audience (customer list)
I require an individual proficient in VB macro script for Mach3. This project entails recreating a Mach4 script that particularly focuses on: - Arc motion control - Tool length calculation from spindle holder to tool tip - B/C axis management and position zeroing I have mach4 script that need to be rewriten to mach3 VB language, I have also a video how it works in mach4 fo refernece. You should be able to implement these specifications based on available documentation. Please remember that the recreated script should maintain as much fidelity to the original Mach4 script as possible. Ideal skills and experiences for the job include: - Familiarity with Mach3 and Mach4 CNC software - Expertise in creating VB macro scripts - Understanding...
I need a profile that accurately captures everything about a soccer player. The output should include: - Player statistics - Match history - Skills and achievements - Personal information Ideal freelancers should be able to come up with a practical plan on how to build this platform, resulting in an in-depth project proposal. The player's statistics should cover basic metrics such as goals, assists, and appearances. Proven experience in sports-related projects will be preferable.
I'm looking for a skilled audio engineer to mix and master a 3 minutes pop cover song. - Genre: Pop - Final Format: WAV The project consists of: - Enhance the audio quality of the track - Ensure the music and vocals are well balanced - Apply appropriate effects for a polished sound - Deliver the final version in WAV format This project requires: - Proficiency in audio mixing and mastering - Experience in working with pop music - Attention to detail for quality output Please let me know your quote and estimated delivery time.
...the client, I'm looking for an experienced Java programmer to build a stripped-down visual representation of Pacman game mechanics for a basic coding project. Only in Programming 4.3 IDE. Key Functionalities: - Pacman Movement: Program the user's ability to control and move Pacman around the maze. - Pellet Consumption: Pacman should be able to eat pellets within the game. - Ghost Behaviors: Ensure ghost characters are present and exhibit the expected behaviors. Design and Visuals: Design need not be complicated. I require a simple, minimalistic design that effectively communicates game mechanics without overwhelming visuals. Ideal Skills and Experience: - Solid experience in Java programming - Previous experience creating game protot...
I'm seeking a professional to convert my PDF file into a Word document. Key Requirements: - The final output should be a fully editable Word file. - It's crucial that the text conversion is accurate, with no room for errors. - While the text itself is of utmost importance, an identical formatting to the original PDF is not necessary. Ideal Skills and Experience: - Proficiency in PDF to Word conversion. - Attention to detail to ensure accurate text transfer. - Strong grasp of English to maintain the text's original meaning and structure. - Ability to maintain a professional and consistent format in the Word document. Please provide your relevant experience and a quote for this project.
I'm seeking a professional to convert my PDF file into a Word document. Key Requirements: - The final output should be a fully editable Word file. - It's crucial that the text conversion is accurate, with no room for errors. - While the text itself is of utmost importance, an identical formatting to the original PDF is not necessary. Ideal Skills and Experience: - Proficiency in PDF to Word conversion. - Attention to detail to ensure accurate text transfer. - Strong grasp of English to maintain the text's original meaning and structure. - Ability to maintain a professional and consistent format in the Word document. Please provide your relevant experience and a quote for this project.
I am in need of a talented animator who can bring my company's logo to life in a 3D animation. This animation will primarily be used in our corporate...in a 3D style as we believe it can make our logo stand out in our presentations. - Color Scheme: The animation should match the current colors of our logo to ensure consistency in our branding. Green Color can be make little Darker if required. Ideal skills and experience for this job would include: - Proficiency in 3D animation software. - A good understanding of branding and how to maintain consistency with the existing color scheme. - A portfolio that demonstrates previous work in corporate logo animation or similar projects. - Output must be 2,048 x 1,080 pixels Mov file. - Duration of video should be a...
Task 1: Write dynamic programming and recursive programs for a given problem obtained from 4 practical task selection test. • Implement a recursive program to solve the given problem. • Analyze time complexity of the recursive program (brute force) and dynamic programming approach using Big O and Omega notations. • Implement a dynamic programming approach by defining a table to store previously calculated values and using them to compute the next value in the sequence. Write recursive solution. • Test both programs for different input sizes and compare their performance. Task 2: Parallelize the algorithms for the second and third recursive equations obtained from the 1 practical selection test, and also ...
Need an expert in WordPress custom theme development with custom PHP coding. No time wasters! Only custom theme and plugin developers should apply. No template proposals, please Thanks!
I am seeking a highly skilled and experienced freelancer who can assist me with a digital signal processing task. This project requires expertise in both audio processing and signal analysis. * **Tasks**: The primary goal is to process recorded audio files and live audio input, analyzing for broadcasting and other applications. * **Source**: The audio and signals you will be working on are from recorded audio files as well as live audio input. * **Output**: The final result should be audio files, real-time visualization, and data analysis reports. * **Ideal Skills**: The ideal freelancer should have extensive knowledge and experience in audio processing, signal analysis, real-time visualization, and data analysis report...
...intermediate-level programmer with experience in Embedded C and 8051 Microcontroller. The project involves designing a system that takes input from 3 sensors and controls an actuator (motor). Key Requirements: - Design a system on 8051 Microcontroller - Program the system in Embedded C - 3 sensor inputs and motor output - Intermediate experience level - Assist in sourcing necessary components I have a strong preference for someone who has worked with 8051 Microcontroller and has experience with designing systems that integrates sensor inputs and actuator outputs. Your role will involve both programming and assisting in recommending and sourcing the necessary sensors and actuator for this project. If...
I'm in need of a skilled Matlab expert that can assist me with an image detection project. The particularities of the images, real-time versus offline processing, and the output format are all flexible and can be discussed according to your expertise and recommendations. Key Requirements: - Proficiency in Matlab - Previous experience in image detection - Ability to discuss and decide on the most suitable approach and output format Feel free to share your relevant experience and suggestions to ensure the project goes smoothly. Looking forward to working with you.
To begin, we’re on the hunt for a highly skilled and experienced freelancer with a strong background in both economics and finance. Specifically, we require your proficiency in Stata and Matlab coding as well as a deep understanding of the Ramsey-Cass-Koopmans growth model. For this project, your responsibilities include but won't be limited to: - Coding in Stata and Matlab with proficiency. - Accurately interpreting and utilizing the Ramsey-Cass-Koopmans growth model. - Applying your economic and financial knowledge for effective economic modeling. We're looking to complete an advanced level of economic modeling. Therefore, you will need to demonstrate a high degree of competence and experienc...
...logic, and ensuring no data is lost or details are overlooked during the transition. The key responsibilities include: Conversion of CodeIgniter Backend to Laravel 11: Migrate the current backend code to Laravel 11 while ensuring functionality and logic remain unchanged. Database Optimization: Optimize MySQL queries for improved performance without altering the existing database structure. Bug Fixing: Identify and fix any existing bugs to enhance the overall stability and performance of the application. API Output: Ensure the new Laravel backend provides a consistent and reliable API output, compatible with current requirements. Performance Enhancement: Implement best practices to improve the performance of the backend system. Req...
I am in need of an experienced website developer with over 10 years of professional coding experience.
...Retrieve historical stock data (price and volume) for a given set of stocks from a reliable financial data provider (e.g., Yahoo Finance, Alpha Vantage). Store the data in a suitable format (e.g., CSV files or a database). Data Preprocessing: Clean and preprocess the collected data, handling missing values and ensuring consistent formatting. Calculate necessary technical indicators, such as moving averages (e.g., 50-day, 200-day), Relative Strength Index (RSI), and trading volume. Technical Analysis: Implement functions to identify bullish signals based on technical indicators, such as: Moving Average Crossovers: Detect when a shorter-term moving average crosses above a longer-term moving average (e.g., golden cross). RSI Oversold: Identify stocks w...
...- Ensure the output of the Python script matches the results produced by the Pine Script on TradingView. - The Python script should be able to handle different data resolutions from 1hr to 1Day. Ideal Skills and Experience: - Prior experience in backtesting trading strategies in Python - Proficiency in Pine Script and familiarity with TradingView - Strong understanding of different data resolutions and how they impact backtesting - Ability to replicate the functionality of TradingView in Python - Good communication skills for understanding the specific requirements and delivering on them. The ideal candidate would be able to understand the complexities of the Pine Script and replicate its functionality in Python. The script should be a...
...completed children's book cover artwork and I need someone with experience in book cover formatting to convert it for IngramSpark's requirements. The specifics of the task are as follows: - Format size: The overall dimensions of the cover should be 8.5x11 inches. - File format: The final output should be in JPEG format. - Content: No additional text is needed on the book cover apart from the title and author's name. - Color: The color scheme of the cover art is already determined. Your role will be in ensuring the cover meets IngramSpark's specific formatting guidelines, not in changing the color scheme. The ideal freelancer for this project would have previous experience in graphic design, particularly in book cover formatting. Under...
I'm in need of an expert statistician, preferably with a background in medical data analysis. Your task will comprise of comparing survival rates within a set of medical patient data. This will include, but isn't limited to: - Conducting survival analysis, with a primary focus on comparing survival rates among different groups. - Your output should highlight significant differences and present the findings in detail. - The analysis needs to include detailed and easy-to-understand graphs, illustrating the comparative survival rates. Skills with statistical software and a comprehensive understanding of survival analysis are necessary for this task. Ideally, you also hold experience within the medical field.
...visual studio 2022, and ChatGPT 4 for a unique project. I require a tool/webpage that can seamlessly re-write chapters of my book for me. My book has 25 chapters. Each chapter contains between 10 and 30-pages. Each chapter is written in MS Word (.docx) document and must be converted into FORMAL and PROFESSIONAL-style content. This project requires the following key features: - **Input & Output Format**: - The system must take a Word document as input. - The output should be a Word document while preserving all the original formatting. - **Language Support**: - The tool should be able to rewrite the document in both English and Spanish. - **ChatGPT Version**: - I prefer the latest ChatGPT 4 for the rewriting task. Ideal ...
I urgently need a skilled Wordpress developer to help me with a few key aspects of my site. - Theme Customization: I have a theme in place but need it tweaked to fit my needs better. I need someone who can customize it without breaking the overall design and functionality. - Plugin Development: I also need some plugins configured and set up for my Wordpress site. The plugins are 3rd party ad need to be confugured. - Ongoing support and troubleshooting I need someone who can start immediately and has great experience in general web page troubleshooting and maintenance, theme customization, plugin development and performance optimization for Wordpress. Your understanding of clean coding practices and SEO optimization is a hug...
I'm looking for a talented illustrator to transform an existing cartoon into a classic style suitable for digital publication. K...suitable for digital publication. Key Requirements: - I prefer a classic cartoon style for this project - The primary purpose of the redesign is for digital publication, so the final output should be optimized for online viewing - The target audience for this cartoon is adults, so the style should be engaging and appealing for a mature audience Ideal skills and experience: - Proven experience in cartoon illustration, preferably with a portfolio that showcases classic style work - Strong digital design skills and the ability to adapt traditional styles for a digital medium - Understanding of audience appeal and...
I have a PDF file with over 50 pages of data in mixed formats - text, numbers, and tables. The task is to accurately transfer this data into an Excel spreadsheet in a tabular format. Key requirements: - Data entry from a PDF file into an Excel spreadsheet - The data is of moderate complexity, so a good understanding of Excel is needed - The output should be a well-organized and clean Excel spreadsheet Ideal skills for this job: - Proficiency in data entry and working with large data sets - Advanced Excel skills, including the ability to work with mixed data formats - Attention to detail and accuracy to ensure the data is correctly captured - Experience with PDF to Excel data conversions would be a plus Please note that whil...
Hello, This is a $20 project. Looking for a freelancer to develop a python script to retrieve restaurant data from Google Maps using the Maps/Places API. The script should target restaurants that have a phone number and *do not* have a website. The inputs I need to enter are: - Location (latitude and longitude) - Search Radius (in meters) - Ensure the business/place is a restaurant, bakery, etc. Key Data to Retrieve, output in a .CSV: - Business Name - Address - Phone Number - Google Maps URL Thank you, trooper501
I am seeking an experienced LT Spice expert to assist with the design and simulation of a half-bridge circuit to drive an ultrasonic cleaner load, 60W, 39kHz, and 10R impedance. I have an LT spice model that needs to be updated to meet the requirement. The floating side needs to show a square wave and the output to the load needs to be a sinewave. The main requirement is to update the values of the discrete component and use a much better MOSFET to meet the required output of 600V AC, 0.5A, 39kHz Responsibilities: - Improve the LT Spice model for the half-bridge circuit (no rectifier needed), Output is AC and not DC - Conduct detailed simulations to analyze performance - Optimize circuit design based on simulation results...
...skilled video editor to help create engaging content for my online Advanced Fitness Training Programs. Key Responsibilities: - Edit raw video footage to produce high-quality, engaging, and professional videos for online training. - Incorporate graphics, transitions, and other visual effects to enhance the overall video content. Ideal Skills and Experience: - Proven experience in video editing, preferably with a focus on sports or fitness content. - Proficiency in using video editing software such as Adobe Premiere Pro or Final Cut Pro X. - A keen eye for detail and the ability to follow brand guidelines to ensure consistency in visual style. - Strong communication skills and the ability to understand and translate my vision for ...
Here we need some of new futures and updates in our app need updates App is in flutter coding for more details can see the documentation all backend part completed need to develop only frontend part only my budget is 4k only interested people participate in bid
...logo with good layers and colors. It's crucial that the final output isn't just an outline in Illustrator with poor quality lines, but a professional vector representation. Key Project Points: - The logo will be supplied in its original format, and I need it to be transformed into an EPS file. - The vectorized logo will be used across both print and digital media, so it's essential that the quality is high and consistent. - I have specific color requirements for the logo, so the final delivery should include the exact color codes. Ideal Skills and Experience: - Proficiency in Adobe Illustrator and experience with detailed logo work - Strong understanding of color theory and the ability to work...
I'm looking for a skilled and experienced coder to work remotely on a website development project. The project involves: - Building a website: Your primary task will be to create a professional website from scratch. This includes developing the site's front-end and back-end, and ensuring it is functional, user-friendly, and visually appealing. I'm open to hearing your suggestions on the programming languages and technologies to be used for the project. Your expertise in coding and web development will be crucial in bringing this project to life. Prior experience with similar projects and a portfolio of past work will be highly regarded. Looking forward to collaborating with a talented coder who can ta...
...the hunt for a certified body contouring specialist, with a keen focus on developing programs tailored for individuals seeking transformation after significant weight loss, after pregnancy or to help lose inches or work on their body goals, If you're well-versed in modern techniques for body sculpting and toning, you could be exactly who I'm looking for. • Contribute Skills: You must have a deep understanding of effective body contouring procedures that will help our weight-loss or people looking to lose inches or tighten and toned clients in making further progress. While not restricted to these, knowledge of Liposuction, a Tummy Tuck, and/or a Brazilian Butt Lift might be beneficial. • Primary Goals: Our objective is to help tr...
I'm in need of a skilled Delphi developer who can quickly generate a program that can dive into the registry of a Windows machine and extract the names of all programs listed in the "Add/Remove Programs" section. Key Requirements: - The code should be written in Delphi. - It should effectively scan the registry. - Extracted program names should be displayed in a listbox. This is a simple task, but it's important that the code is efficient and free from bugs.
...personal assistant with strong recruitment skills to help me find volunteers and mentors for a project I'm trying to get off the ground. That will entail posting on job boards and discussing the projects with potential volunteers and mentors, and then connecting suitable volunteers and mentors to me. The work you will be recruiting for can be remote or in person, the remote volunteers can work from anywhere and the in person volunteers need to be prepared to meet once or twice a week to raise the project profile in person. IMPORTANT NOTE: the freelancer role is not to be a volunteer, but to help me recruit volunteers online. I will provide more details to suitable applicants, such as which project we will be recruiting volunte...
I have a project that requires extensive knowledge in Scala Java, focused on analyzing post metrics from social media. Responsibilities include: - Coding in Scala Java to retrieve and analyze social media post metrics - Performing data analysis in order to draw actionable insights The suitable freelancer for this job is someone with previous experience in Scala Java and data analysis, preferably involving social media data. The task requires in-depth knowledge in data sorting and categorization methods and a good understanding of social media platforms.
...hand (by artists like me) in favor of computer generated faster/cheaper AI images. The conversion and restoration of old slide images of my artwork using software programs to remove dust, discoloration, etc. is very labor intensive before the artwork image will be ready for digital printing and marketing online which will generate an income from digital prints. I cannot borrow the money we need to fix the roof & stay in business. I have no retirement income; Social Security only counts the last 10 years of employment before you apply for SS benefits and those were my worst years handicapped with injuries so I can’t exist on SS. If we lose phone & internet, we’re totally cut-off from the world and honestly, I doubt that I cou...
I'm in need of someone to transcribe an mp3 audio file into a verbatim style text. The audio features m...mp3 audio file into a verbatim style text. The audio features multiple speakers, but speaker identification is not required. The final output should accurately capture not only the words spoken but also include all the utterances, non-verbal sounds and pauses. This is important to maintain the original context and tone of the conversation. Ideal Skills and Experience: - Proven experience in transcription, especially verbatim style - Ability to accurately transcribe audio with multiple speakers - Attention to detail to capture non-verbal sounds and pauses - Good command of English language - Reliable and able to deliver on time - ...
...get my BMW 5 series coded to both enhance its performance and add some personalized touches to it. The project should be completed within a week. Key tasks include: - Engine Performance: The engine should be tweaked to generate more horsepower, making the car more powerful. - Fuel Efficiency: Along with boosting the engine's horsepower, you need to alter the coding to make the car more fuel-efficient. - Lighting Effects: The vehicle's lighting system should be adjusted to custom effects that suit my personal preference. - Audio System: The coding should also improve the car's default audio system to offer a superior sound experience. Ideal candidates would be familiar with BMW coding, particularly for the 5 series mod...
I am seeking a highly skilled web developer to c...photography-oriented website. The primary features should include: - Image galleries sorted into specific groups. - User interaction, such as the ability to upload, comment on, and rate photos using a numeric scoring system from 1-10. - User registration via social media login, providing ease and efficiency for active social media users to interact with the site. - A comment moderation system that auto-approves comments but allows for manual review if necessary. Your experience in building web platforms with user generated content will be valuable, as will knowledge of rating and moderation systems. Fluency in coding that enables smooth social media integration is key in this project. Please bid ...
...designer and developer to work full time on our customers websites. Your primary responsibilities will include graphic design, HTML/CSS coding, JavaScript and Bootstrap programming in Spanish and English Key Responsibilities: - Develop and maintain websites using HTML, CSS, JavaScript and Bootstrap using our proprietary CMS. - Implement interactive features and dynamic content using JavaScript. - Optimize images for fast loading. Must be strong in responsive design using CSS media queries. Skills and Experience: - Proficiency in Graphic Design software. - Strong experience in HTML/CSS. - Proven track record in JavaScript programming. - Ability to work creatively and proficiently. - Excellent communication ...
...Developer with a flair for mobile development and UI/UX design. You'll take charge of designing, coding, and modifying mobile applications to enhance user experience. This role requires collaboration with cross-functional teams to bring new features to life and ensure our applications are both robust and responsive. **Key Responsibilities:** - Design and build advanced applications for both iOS and Android using frameworks like Flutter. - Work alongside other teams to define, design, and deploy exciting new features. - Focus on application performance and user experience. - Maintain high standards of code quality and push for continuous improvement. **What You Need:** - BS/MS in Computer Science, ...
- Implementation of a feature that toggles audio output between Speaker and earphone in a React Webview screen inside a React Native app - The feature should be user-friendly, enabling seamless switching between the two audio outputs Ideal Skills: - Proficiency in React Native and React - Experience with audio output handling in mobile applications - Understanding of Android audio controls and React Native Webview integration If you have the necessary skills and experience, please get in touch.
I'm seeking a skilled Python developer with exceptional capabilities in algorithms and data structures. Your primary task will be to develop an innovative solution for a Disjoint Union Set problem. Key Responsibilities: - Develop a new solution from scratch - Implement a Disjoint Union Set algorithm in Python - Ensure the algorithm is efficient and correct Ideal Skills and Experience: - Proficiency in Python is a must - Deep understanding of algorithms and data structures, specifically Disjoint Union Set - Strong analytical and problem-solving skills I have a code already but npot working but i recommend u start from skratch here is the problem please read it, the problem is tricky As it is the best SHS course, the teacher allowed you to...
... A skilled developer with expertise in creating a dynamically pixelating images (not simple machine or grid pixelation). The program should have the following functionalities: - dynamically pixelate any imported image into mathematical, non-mathematical or custom shapes in various styles with user adjustable settings and configurations - adding additional shapes into the created shapes in separate layers to create more complex outcomes - export of the pixelated images as 300dpi vectorized or rasterized files - intuitive interactivity with user friendly adjustments, selections and editing The ideal freelancer would have extensive experience in graphic programming, creating image pixelation algorithms and a strong background in developing highl...
I'm looking to create an appealing short video commercial for our English Summer School that will be shared across social media. The aim of this video is to increase enrollment and, while doing so, provide some information on the specific attributes of each of our five branches. The successful freelancer should ideally have: - Proven expertise in creating compelling live-action video content suitable for social media - Excellent storytelling skills and the ability to differentiate between the general and specific content provided for each branch - A high degree of adaptability to utilize the provided assets and similar video samples The video should be approximately 8 to 9 frames long; assets, including sample videos, will be provided to aid your creati...
I'm searching for a skilled Python developer with a solid background in machine learning and image recognition to work on a project to help me write a python code that can detect the questions on a scanned image and crop them into different images. You can use any library or package. Key Tasks: - Object Detection: I require the developer to implement object detection capabilities within my image recognition system. - Text Blocks Detection: I need a method to accurately detect and interpret text blocks within images. The ideal candidate should have: - A strong background in Machine Learning, especially with Python. - Extensive experience in object detection and image classification. - Expertise in text blocks detection would be a great adv...
...who can help create our app for iOS, Android, and web platforms. Key Responsibilities: * Develop Ionic application adapting to our detailed design * Seamless integration with a specific cloud service * Maintain code and fix bugs when required * Create functional, responsive, and smooth UI Skills and Experience: * Proven experience as an Ionic developer * Fluency in mobile platforms: iOS and Android, and web * Proficiency in cloud services integration * In-depth understanding of coding and the ability to troubleshoot and analyze websites for speed, functionality, and aesthetics * Knowledge in making architectural recommendations To be most successful in this position you should have a keen eye for detail,...