Vb.net client server database application punët
Office 365, Wordpress server admin, closed server admin
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
mahdi mmahdi ta,dty kzgyshj dkgsigd hydgw sgjxfyhs
My project in detail sepse une jam nje bos i madh e venit o bab o bab hahahhahah
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
,,jkhkgjhcfxdtycfuvbinm', .':;lkljgkhjhfgjkl;'
dfdvvdevfceacvfvfev bhbjhbjhb jhjbhjhjvhjvjh jhvhjvjhv
android apksdnjasdsjcvsdb hjvbciasdc cs iudc bsbc iudvs scnsjkdhiosdjsc juhsjkchdjcfhbjdcsdbcvujdncjksdcbhsdhsdgc
android apksdnjasdsjcvsdb hjvbciasdc cs iudc bsbc iudvs scnsjkdhiosdjsc juhsjkchdjcfhbjdcsdbcvujdncjksdcbhsdhsdgc
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
i knoq adasfas fasfa fa fa jkjkjljfla
Vhjjhkbhjjffjkvhjjghkjghnnjjjhhhhhhhhhhhhhhhv
[test] slkdjlasdjalkd jldj ladkj ldjsadlkjd dj sldkjd a
Trabajar Jdkdidod Nsnddjdhdjdhdhdjshshshjsj
make a c applicatoionniwahdjksajk jksadbkjasbdkj bksajbdkjsabkjdb jaksbfkjasbkfjb kasjbfk bsakj bksjafbaksjbc
Our laboratory management application, currently built with french, requires enhanced communication capabilities with Data Management Systems specifically for real-time data synchronization. Key requirements: - Facilitate seamless, real-time data exchange between our laboratory management application and the Data Management Systems. - Ensure data integrity and reliability throughout the synchronization process. Ideal skills and experience: - Proficiency in the programming languages French is built with to ensure seamless integration with the existing application. - Proven experience in developing real-time data synchronization mechanisms. - Strong understanding of data management systems to facilitate efficient communication and synchronization. - Ability to ensure ...
We have a project which needs an expert who is experienced with either Haraka or Postal. The project requires understanding, building and managing SMTP infrastructure on a deep technical/engineering level. To simplify the project it revolves around receiving email, modifying some of the headers and then sending it on for delivery. We expect there to be some development involved to achieve the final desired outcome. The full details will be explained in further discussions. We will need the installation and testing of the solution and ongoing support and consulting after implementation. Please note, we are specifically looking for a technical expert in handling Haraka/Postal/SMTP. This is NOT a project focused on email delivery as it is applied to marketing type emails and reputation man...
We are looking for a skilled WordPress developer who can handle two main tasks: integrating e-commerce ...Conducting website performance tests • Monitoring the performance of the live website • Experience optimizing web pages and improving page speed • Collaborate with internal teams to produce software design and architecture • Write clean, scalable code using NET programming languages • Test and deploy applications and systems • Revise, update, refactor and debug code • Improve existing software • Serve as an expert on applications and provide technical support • Designing and managing the website back-end including database and server integration • Generating WordPress themes and plugins Payment will decide...
...specialist in server maintenance and troubleshooting, particularly for my Dedicated Linux Server Level 2 Strato. The key tasks required are: - Recovery: I need help with server recovery, the ability to troubleshoot and restore the server in case of failure. - Update: Keeping the server software up-to-date is crucial for security and compatibility. I need a specialist to handle the server updates effectively. Ideal skills for this job include: - Strong expertise in Linux server administration and management. - Proven experience with server recovery procedures. - Proficiency in updating server software without causing disruptions. - Strato dedicated server recovery - Operating system Ubuntu 16.04 LTS 64bit + Plesk On...
My business, , is in need of a talented SEO expert to help us achieve our primary objective of attracting new clients from the EU. Key Focus: - The main area of improvement required is technical SEO and website performance. This includes on-page elements, site speed, mobi...of the business, and how it appeals to potential clients. Skills and Experience: - Proven track record of successful SEO campaigns, specifically in attracting clients on a regional level. - Proficiency in technical SEO techniques and tools, with experience improving website performance. - Understanding of marketing services and the ability to utilize this knowledge in optimizing the site for client attraction. - Good communication skills and a collaborative attitude to work alongside our team.
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
...urgent server configuration and API integration tasks. Specifically, I would require the following: - Server Configuration: I need someone who is well-versed in server setup and configuration, ensuring a smooth and efficient back-end infrastructure. The ideal candidate should be able to ensure optimal performance and security. - API Integration: There is a need for the integration of an 'informative application' API. This task requires someone with prior experience in integrating custom APIs and a strong understanding of how to effectively connect APIs for seamless functionality. Ideal Skills and Experience: - Proficient in PHP for backend development. - Strong background in server configuration. - Demonstrated experience with API integrat...
I require an experienced web developer to build an e-learning web application. The primary audience will be college students. Key Features: - User authentication for security - Course management system for curriculum organization - Progress tracking to monitor student development Learning Resources: - Videos and interactive exercises for active, engaging learning - Quizzes to assess understanding and retention. The ideal candidate will possess a proven track record in web development, specifically with e-learning platforms, and a deep understanding of user experience design for educational purposes.
Hiring a skilled WordPress Developer for ongoing agency client work. IMPORTANT: - Must be available to work 8 hours per day during US Central Time (Monday to Friday) - All work must be performed on a Windows Remote Desktop which comes with fast internet, strong processor and license to all required tools like Photoshop, code editor etc. The developer will be responsible for daily tasks that include updating web pages, integrating new features into existing WordPress sites, and handling some graphic-related tasks, such as designing and setting up email newsletter templates. Requirements : - Proficiency in WordPress, including themes and plugins - Experience with HTML, CSS, JavaScript, and PHP - Ability to work with graphic design tools such as Adobe Photoshop or Illustrator for b...
I am looking for a Docker engineer for a project on a Windows operating system. We will be focusing on running a web application and would like to implement a continuous integration/continuous delivery (CI/CD) pipeline in our operations. Key responsibilities would ideally include: • Building Docker solutions for our Windows-based web application • Setting up an effective CI/CD pipeline Skills and Experience: • Proven experience in Docker engineering • Strong grasp on Windows-based systems and web applications • Knowledge in setting up CI/CD pipelines • Proficient understanding of containerization technologies I anticipate the potential for ongoing work if this project is successful. Please attach examples of similar Docker projects you have ...
As a client, I am in need of a professional and skilled Prepress artist who can effectively handle PDF file preparation for printing using Adobe Illustrator. Ideal Skills & Experience: - Expertise in Adobe Illustrator software. - Previous experience with PDF files for print preparation. - Strong understanding of prepress production techniques. - Deep knowledge of publishing standards and specifications. Tasks: - Preparation and optimization of PDF files for the print process using Adobe Illustrator. Candidates who demonstrate a solid track record in a similar field will be considered first.
I am looking for an expert who can help me set up a SIP trunk server using Twilio as the SIP provider. This server will be used for both voice calling and SMS messaging. Key Responsibilities: - Establishing a SIP trunk server with configurations optimized for Twilio - Implementing call management features like Call Recording, Call Forwarding, and Interactive Voice Response (IVR) - Ensuring seamless integration of both voice and SMS capabilities - Providing recommendations for server security and performance optimization Ideal Candidate: - Extensive experience with SIP trunking, particularly with Twilio - Proficiency in configuring and customizing SIP trunk servers - Proven track record in implementing call management features such as Call Recording, Call Forw...
I'm looking for help with a professional writing for a business loan application forms to fill in and send back to me. Key requirements: -fill in the question and write a user-friendly loan application form for high success rate. - there are 2 forms to fill in 1- Business plan template 2- cash flow template, they are in Microsoft excell file, once filled in just save and return to me so it is ready for the application upload. Ideal freelancer will have: - Proven experience in English literature - Strong understanding of business planning and growth. The application form is an essential part of the loan application process, with few questions which asks how the business growth and planning , once is written I can review for the final outco...
...techniques, transitions, effects, and color grading. 3. Incorporate audio elements, music, sound effects, and voiceovers to enhance the overall impact and emotional resonance of the video content. Creative Direction and Concept Development: 1. Provide creative input and guidance during pre-production meetings, script development, and storyboard sessions to ensure alignment with project goals and client objectives. Promo Production: 1. Develop and produce promotional content, including teasers, trailers, and ads, to effectively market and promote projects. 2. Collaborate with marketing and creative teams to align promotional materials with branding and campaign strategies. 3. Conceptualize and execute engaging promotional campaigns that capture the target audience's attenti...
I'm in need of an expert who can help me with the following tasks on my existing server: - **Server Configuration:** Fine-tuning and optimizing my server settings to ensure it's running at its best. - **DNS Management:** Managing and configuring my domain's DNS settings to ensure proper functionality. - **Email Setup:** Setting up email services on the server for my domain. I will provide you with root access to the server, so you should be well-versed in security practices and able to handle the responsibilities that come with that level of access. Ideal candidates should have: - Extensive experience in managing Cpanel and WHM - Strong knowledge of DNS configuration and management - Proficiency in setting up email services - The abil...
...in the process of launching a consulting business focused on staffing services. I'm in need of a talented Client Acquisition Specialist to help me secure freelance staffing clients. Key Responsibilities: - Engage in the overall sales process , from lead generation, initial outreach and closing deals. - Develop an effective client acquisition strategy. - Reach out to prospects through various channels (e.g., email, social media, networking). - Present our service offerings in a compelling way to convert leads into clients. -Secure deal closures by skillfully managing negotiations and terms. -Establish and sustain robust client relationships. Ideal Candidate: - Proven experience in client acquisition, ideally within the consulting or staffing industry. -...
...SEO checks and adjustments. Day 13: Client Review and Feedback Present the fully developed website to the client for review. Gather feedback and make any necessary revisions. Day 14: Final Delivery and Launch Implement final changes based on client feedback. Ensure all pages and features are fully functional. Launch the website and provide a brief training session on managing the site through WordPress. Preferred Qualifications: Experience working with IT managed services companies or similar industries. Familiarity with content management systems (CMS) like WordPress, Drupal, or similar platforms. Strong understanding of UX/UI design principles. Knowledge of SEO best practices. Ability to work independently and meet tight deadlines. Application...
...Stripe, PayPal). • Implement APIs to handle payment transactions, process payments, and manage payment statuses. 3. Document Management: • API for users to upload documents. • Secure storage of documents. • API for admins to update the status of submissions. 4. WhatsApp Integration: • Integrate a WhatsApp Business API. • Implement APIs to handle user inquiries and provide automated responses. 5. Database: • Design a schema for storing user data, submission details, payment transactions, and status tracking. • Tables: Users, Submissions, Payments, Statuses, Chat Logs • Ensure data integrity and security. Main Integrations 1. User Registration and Authentication: • Enable users to create accounts and securely log in. 2. Payment Gate...
I'm looking for an exhaustive list of Australian gym owners, with a focus on capturing between 100 to 500 individual records. The data needed includes, but not limited to: - Owner's Email Address - Gym's Name - Gym's Website Ideal candidates for this job are experienced data miners and researchers. Having a good understanding of the Fitness industry would be beneficial. Strong attention to detail is paramount, ensuring accuracy in data collection and entry. Additionally, demonstrating respect for privacy laws and guidelines, including GDPR, is essential. Experience with spreadsheets and CRM systems would be advantageous. Gyms must be privately owned only, non franchise. Offer Personal Training. Boutique Exclude: Category - Fitness Equipment Category - Community He...
As a project manager for our website, you'll be responsible of working closely with the client, developers and designer to complete website projects. Key responsibilities include: - Managing the design and development process, ensuring the website meets our needs. - Provide website content that is aligned with SEO best practices - Basic understanding of website development - Ability to work on simple website projects (WP) and complex website projects (Portals) - Understand domain DNS configurations, Email configurations, and server configurations. The ideal candidate will have: - Proficiency in Arabic and English, with an ability to translate content effectively. - Experience managing website projects, particularly those with high customization requirements. - St...
It is necessary solve two bugs to a Laravel application regard the frontend of condition use php 7.4. if it is necessary you must do changes to the database and the backend
...YOU on our team! We're a High Converting Website Design Agency looking for a driven, commission-only sales superstar to join our ranks. In this role, you'll be responsible for: Prospecting and Cold Calling: You'll identify potential clients who need a website refresh or a brand new online presence. Be prepared to make a positive first impression and build rapport over the phone. Understanding Client Needs: You'll have a knack for uncovering a client's vision and translating that into actionable website goals. Selling Solutions: You'll present our web design packages with confidence, highlighting the value we bring to their business. Closing the Deal: You'll guide clients through the sales process, securing their commitment to a website project...
I need an experienced Wordpress developer to create a custom online form on my website using WPForms. The form should save all submitted data to a database. Here are the specifics: - **Export Data:** The form's data should be exported in Excel format. - **Client Communication:** The data collected needs to be sent to the client as a PDF document. - **Form Fields:** The form should include fields for 'Contact Information', 'Service Request Details' and 'User Feedback'. This project also includes the task of taking a form I already have in PDF format, and converting it to a WPForms. Please note that this form is quite complex, so experience with custom fields and complex form layouts is desired. Ideal candidate should have: - Stron...
...developer to make a set of changes to my existing web application. The application is built on .NET, C#, MVC and MSSQL. The main areas of focus are: - **Database modification(If need)**: - **Adding New Features(If Need)**: I'm looking to integrate some new features into the web application as per requirement. - **Front-End Modifications**: I need some enhancements on the front-end, focusing on design/UI changes as per requirement. Additionally, the project would also involve: - **Back-End Modifications**: These would be required to ensure the new features are implemented effectively. - **Bug Fixes**: Any existing issues within the application should be identified and rectified. The ideal candidate should have extensive experience in ....
...This webpage should be capable of updating a database based on the scanned QR code information. I'm not entirely sure whether an existing database can be used for this project, so your experience in setting up databases would be a plus. Key requirements and decisions to be made: - Setting up a Laravel project with QR scanner functionality - Integration of the scanner with a database to update it according to scanned QR codes - The system should handle multiple scans of the same QR code by the same user by ignoring subsequent scans - The primary action the system should take is a check-in/check-out registration process, triggered by the QR scan Ideal skills and experience for the job: - Proficiency in Laravel and PHP - Experience with database setup...
I'm seeking someone with a built-in infotainment system who can test an application for retrieving speed and fuel level data via Android Auto. I'm interested in verifying whether the application accurately displays the car's speed and fuel level.
As the client maneuvering through the competitive health supplement industry, I'm in search of a talented and creative freelancer to design my product packaging. Key Requirements: - Expertise in designing product packaging, specifically for health supplements. - Strong understanding of designing product visuals that effectively appeals to my target audience – adults and seniors. - Ability to bring creative ideas to the table, yet embody the wellness and trustworthiness of the product through design. - Keen awareness of industry trends and competition. The freelancer should be able to showcase a strong portfolio of product packaging designs, especially within the health supplements sector, demonstrate excellent communication skills, and deliver projects within deadli...
...developer to implement DTLS in C for secure communication within a tight deadline of two weeks. Key project requirements: - Implement DTLS in C: The primary goal of this project is to introduce DTLS to an existing system for secure communication. - Tight deadline: This project needs to be completed within two weeks. Timeliness and reliability are crucial. I need the data coming from the server to the client over UDP socket to be encrypted with DTLS, and it should appear as DTLS in the protocol section of Wireshark. In addition, the code should be able to handle streaming video or live feed over the socket accordingly. This code should work in linux and windows. Ideal Skills and Experience: - Proficiency in C: Extensive experience with C language is a must. - DTLS Know...
Before you respond on Freelancer.com, please take a minute to read this document in full. There is no rush. Also view our "Client profile" before you bid. We are a reputed employer with excellent previous ratings. The chosen freelancer will receive positive feedback score and prompt payment. ----------------- About the subject ----------------------- This is a 3-hour project to create 3 videos which explain how to use a new software which we have created The deadline is sacred, we cannot extend the 3 hour timeline. ---------------- About the video ------------------- Video script: (See attached file - Video ) --------- Other details ------------------------- No voiceover is required. Generic background music is required, something light and peppy. Please bid ...
...get all of the following INCLUDED with NO HIDDEN COST in a YEARLY price of 129 USD: ➡️ Be among the elite few to earn the new IFC badge on your profile so that you can stand out! (Upon successful completion of the test) - Priceless! ➡️ Unlock hours of groundbreaking video content I’ve been working on for months that's nowhere else to be found. (399 USD, INCLUDED!) ➡️ Numerous attachments with client conversation pipelines, strategies, tools and much more! (199 USD, INCLUDED!) ➡️ Dive into biweekly live streams with the masters, ask anything you want, and pick up secrets they don't just share with anyone. (100 USD per hour, INCLUDED!) ➡️ An overview with my thoughts of all newsletters I'm subscribed to in freelancing/AI/Digital, giving you the edge you ne...
I am in search of a skilled Vue.js developer to create a brand new web application. This project requires the following: - **Vue.js Expertise**: The ideal candidate will have a solid understanding of Vue.js, and be able to demonstrate experience with building applications from scratch. - **API Integration**: A key part of this project will be integrating the application with APIs. The developer should be proficient in working with various types of APIs. - **Mobile Responsiveness**: The application must be mobile responsive, so it is crucial that the developer has a strong understanding of responsive design principles. The successful candidate will have a good eye for design, be able to translate requirements into code, and be a clear communicator. Please provide exam...