Webtable cell reference vb punët
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I need a talented graphic designer who can create engaging cartoon-style comic graphics for my website. Ideal Skills: - Proficient in creating cartoon-style graphics - Experienced in creating content for websites Reference: I need 5 different graphics. I will need them fast.
Merhabalar elimde PHP bir web sitesi mevcut bu siteden girilen Bilgileri android webvirew ile çekiyorum komlpe sayfayi örneğin Instagram profil resim vb gibi eklemeler yapınca geçerli uygulamaya yonlendirmiyir sadece Türkçe dilini bilen arkadaşlar irtibata gecsin
...script. You don't need any knowledge of Sanskrit, all content will be provided. Content: Include animation and explainer elements to make the content engaging and easy to understand. Music and Footage: Start with popular Western music and relevant footage, then transition to the study content. Interactivity: Incorporate an interactive element, such as a quiz or a prompt for viewer engagement. Reference Material: You may use the attached material or your own content. Submit your sample video for a chance to work on this exciting educational project and contribute to the revival of Sanskrit! There are up to 20 episodes planned, with a total budget of between £1,000 and £2,000 for the entire project....
I'm struggling with a blurry photo where objects are indistinguishable. I require professional enhancement to decipher the objects in the image. I also have video footage containing these objects for reference. Ideal candidates for this job should have: - Extensive experience in image enhancement - Proficiency in photo editing tools - Ability to work with accompanying video material - Strong attention to detail This task will require someone skilled in object identification from blurry footage and implementing the right techniques to improve overall sharpness. Please only bid if you have the necessary skills and tools to perform this task. Let's clarify this mystery picture together! Look like a phone to me I want to confirm it and see the screen at top of video on...
I'm looking for a talented developer to create a comprehensive video software demo that can showcase our product for marketing purposes. Note: The software is not done yet. So you will have to use reference site as demo. The software demo is Y-Combinator meets Kickstarter for Black-Americans. Key features to display 1. crowdfunding platform, which allows people to raise money for creative projects and people to pledge money to projects 2. entrepreneur matchmaking- which allows entrepreneurs to connect with team members 3. online courses - to educate people on investment and other money-making topics Requirements: - The demo should be user-friendly, with a clear interface that highlights our product's key features and benefits. - The software should ideally be de...
...Store the JWT token in the browser's localStorage or sessionStorage • Interception of HTTP Requests: Use Axios interceptors to add the JWT token to the header of all requests. Handling ERROR and SUCCESS Messages with Pop-ups • Error • Success Credit Card Tokenization on the Front End • Use API to tokenize credit card information before sending it to the backend Device Responsiveness • Cell phone • Desktop • Notebook • WideScreen Monitors • Tablets Pagination of Cards on the HOME Page and SEARCH RESULTS Page • Pagination Implementation: Use a pagination library like react-paginate . Organization of Cards, according to the Filters Used in the Search Results • Available Filters: Category Price Location Avail...
I am looking for an expert to put together a professional sales report using Sisense, solely based on my e-commerce platform data. Key Information: - The report should focus on sales statistics and trends, analyzing data collected from our e-commerce platform. - The main purpose o...if the report is visually appealing and easy to interpret, as this will be shared with different teams in our company. Skills & Experience: - Proficiency in Sisense or similar BI tools is a must. - Previous experience creating sales reports is highly desirable. - Understanding of e-commerce data, especially sales metrics, is crucial. Please note that the report you provide can be used as a reference for future reports, so a well-documented process of how to update and maintain the report would ...
I'm looking for a skilled designer who can create a modern and sleek postcard mailer for my residential service company. This design will serve as the primary method of advertising our services to homeowners. Needs to have mailing label per the attached instructions. Key Requirements: - Visual Appeal: The postcard should be designed ...particularly postcards. - A strong understanding of design principles and an ability to create visually appealing layouts. - Experience in creating designs for residential service companies or similar industries would be a plus. If you have a portfolio of similar projects, I'd love to see it. Looking forward to working with a creative and experienced professional. Attached is our brochure for reference to the company. And logo. Also our w...
I'm seeking a skilled blog writer to compose an in-depth blog post exploring the reasons behind Nokia's decline in the mobile industry. The piece should be written in a professional and formal tone, and should be a minimum of 1000 words. Key Project Requirements: - Blog post should be 1000+ words - Tone: Formal/Professional - Research: The blog post should reference from reputable academic journals or books. Ideal Skills & Experience: - Proven experience in writing professional blog posts - Strong research skills with the ability to draw on academic sources - Understanding of the mobile industry or previous experience writing about technology would be a plus. Please submit your portfolio or relevant writing samples with your proposal.
Description: I am looking for a skilled graphic designer to create a detailed graphic design for my bathroom furnishing project. The design should include 5 variations based on the styles I have selected on Pinterest. I will provide you with images of the styles for reference. Please incorporate the provided dimensions and specifications into the designs. Requirements: - Create 5 variations of bathroom furnishing designs. - Use the styles referenced from Pinterest. - Incorporate the provided dimensions and specifications (quotas) into the designs. - Deliver high-resolution files suitable for implementation. Skills Needed: - Proficiency in graphic design software (e.g., Adobe Photoshop, Illustrator). - Experience with interior design or home furnishing projects. - Ability to trans...
...for the store. It should be visually appealing, user-friendly, and align with the latest design trends. - **Customization:** Customers should be able to upload their own designs, so the store needs to integrate this feature seamlessly. Ideal freelancer for this job should have: - **Proven Experience:** I'm only considering candidates who have built similar stores in the past. Please provide reference links to your previous works. - **E-commerce Expertise:** Knowledge of e-commerce platforms and experience in setting up online shopping carts for print products is crucial. - **Design Skills:** A good eye for modern, sleek design is a must. The store should be visually attractive and engaging for customers. - **Customization Features:** Experience in implementing user-friendl...
Develop a chatbot with a web chat interface using the Llama 2 7bn LLM model to assist users in resetting their passwords. The chatbot will interact with users to collect verification details (employee number, name, date of birth, boss's name, and last four digits of cell number) through a structured conversation. The system will validate user inputs against an API and terminate the conversation after three invalid attempts. Upon successful verification, a text message with the new password will be sent via an external API. The project will include creating APIs for future speech input/output integration, ensure response times under 1.5 seconds, handle multiple simultaneous users with unique identifiers, and provide customizable response messages. The system will be deployed on ...
My company has a logo, recently I noticed a very nice brush effect on another company's logo that I want to apply to my current one. I have the reference so it should be very quick and straight forward . thank you, the reference is attached below
My goal is to have my truck custom painted in black and yellow. I have a specific design in mind which I can share via pictures. - The paint job should represent the design exactly as shown in the images. - I will provide the paint so there's no need to worry about procuring it. - Applicants should demonstrate their past experience related to this kind of work. Ideal applicants ...design exactly as shown in the images. - I will provide the paint so there's no need to worry about procuring it. - Applicants should demonstrate their past experience related to this kind of work. Ideal applicants would have: - Extensive experience in painting vehicles, especially custom projects. - Keen attention to detail. - Capacity to interpret and reproduce a design from a ...
My goal is to have my truck custom painted in black and yellow. I have a specific design in mind which I can share via pictures. - The paint job should represent the design exactly as shown in the images. - I will provide the paint so there's no need to worry about procuring it. - Applicants should demonstrate their past experience related to this kind of work. Ideal applicants ...design exactly as shown in the images. - I will provide the paint so there's no need to worry about procuring it. - Applicants should demonstrate their past experience related to this kind of work. Ideal applicants would have: - Extensive experience in painting vehicles, especially custom projects. - Keen attention to detail. - Capacity to interpret and reproduce a design from a ...
I'm looking for a professional with sound knowledge of Chicago style referencing to reference my 2,000-word essay. Key Requirements: - Chicago Style Expertise: You should be well-versed with the intricacies of Chicago style referencing, particularly for academic essays. - Extensive Reference Experience: I need 35 sources to be meticulously referenced in my essay. - Footnotes: I require the references to be formatted as footnotes. This project has a 24 hour deadline as I’ve got to submit it tomorrow.
...illustration for this year's shirt. Project details are below. 1. Deliverables - 1 editable illustrator file with illustration for front of shirt 2. Last year's shirt is attached for reference. 3. The illustration should be of our mascot kicking a football (American football) over the stadium through the field goal posts (see attached sketch) 4. The stadium is already drawn, pull this from last year's file (attached ). Just need to change the year inside to 2024. 5. The illustration of the mascot kicking the football should match our previous styles, I will send a zip file with reference images from past t-shirts. We want the illustration to have some motion with the mascot kicking the ball. 6. We need this done within 48 hours. Can provide any assistance n...
I'm in need of a CSS specialist who can meticulously recreate a graphic using CSS, ensuring the appearance and effects remain consistent across different devices and browsers. Expectations: - Recreate the graphic involving rings/circles, focusing on replicating the gradient color, glow/light shadows/neon effect, and depth. - The placement of rings/circles doesn't need to be identical to the reference image, but the overall look and effects must be maintained. Key Requirements: - Strong CSS skills with a proven track record in creating visually appealing and interactive designs. - Familiarity with various CSS effects, particularly gradient colors, glow, and depth. - Ability to ensure compatibility and responsiveness across different browsers and platforms. Please note t...
I am looking for someone who can create a frontend website (no need admin) looking like reference website (see URL below). Your creation must be unique, but we need a fancy looking GUI and animations. You can pick your own animations and elements. Reference site: Less then 1000 Euro? DM and we can make a deal. More then 100 Euro? Please do not bid.
3D Video of Product reveal according to Instagram reference.
We have built a customized website in core php and need another experienced developer to join the team to fix some bugs, We are looking for a very experienced php developer for our project, you must have at least 12-15 years of experience with a good reference . Must have experience in multi-user programming, must know how to do quality coding, fix sql injections Conditions: You must be a independent freelancer. and share with some of your customized applications that u have worked on.
Fixed cost & developers from Uttar Pradesh only . I'm looking for a skilled freelancer who can help me develop a real-time temperature display system using NodeMCU ESP8266. Key Project Requirements: - Integration with 3 or more Bluetooth BLE sensors - Real-time temperature display on an LCD screen - Parsing advertisement data from nearby paired BLE sensors - Data sheet will be supplied for reference Ideal Skills/Experiences: - Proficient in programming with NodeMCU ESP8266 - Experienced in working with Bluetooth Low Energy (BLE) technology - Familiarity with parsing advertisement data - Knowledge of connecting and operating LCD displays This is a fixed cost project with a budget under $100. Please provide your quote for the project, along with your relevant experience...
I need a PHP script to update an existing PDF file with data from a form. - The purpose is to update information in the PDF file, not generate new ones. - The edited PDF will be displayed once, not saved for future reference. - The data that I'll be entering into the form is a bit more complex than just text. It includes text, images, tables, etc. The ideal freelancer for this project should have: - Strong understanding of PHP. - Experience with PDF manipulation in PHP. - Ability to work with various data types in PDFs. - Attention to detail to ensure the PDF retains its original style, font, spacing, etc.
We are the p...increase brand awareness, your content should be engaging and cause widespread sharing and liking on the platform. The ideal candidate should have: - Look comfortable in front of the camera. - Fluent in English or Spanish - We cater to the North American market, which would be great if you are American or Mexican Ability to work independently and under strict deadlines. Our team will provide the reference template and text content of the video, you can directly imitate or adapt the shooting. We will be responsible for the later editing, production, and release in our account. If you can create interesting, unique, and engaging TikTok content, you may be the perfect candidate for the position. For the right freelancer, the possibility of a long-term partnership is on ...
...boot sequence completes. This issue arose without any identifiable trigger, as I was not involved in any software installations or system updates immediately prior. I'm looking for an expert to diagnose and resolve this problem. Key Tasks: - Diagnose the cause of the crash - Implement a solution to prevent future crashes - Provide any necessary documentation/troubleshooting steps for future reference Ideal Skills and Experience: - Proficient in Ubuntu 20.04 system administration - Experience in diagnosing and resolving system crashes - Strong troubleshooting and problem-solving skills - Excellent communication to provide clear documentation and explanations The ultimate outcome from this project is for the Ubuntu system to operate without any crashes post-boot. Your work...
...yellow, and I need them to be transformed into Red, Blue, and many more variants. This project is straightforward for someone who is proficient in using the Hue/Saturation filter in Adobe Photoshop. Scope of Work: - Your task is to change the color of these products to given color, ensuring that the new colors look natural and appealing. - I will provide one reference image with the exact colors I desire. You will use this reference to match the colors accurately in the other images. The main objective is to update the color scheme of our products. The new color scheme will be essential in our rebranding process, helping us to align our products with the new brand identity. Ideal Skills: - Extensive experience with Photoshop, particularly with the Hue/Saturation tool -...
Convert 2 page brochure from PDF to AI files. Recreate source files from PDF for easy editing. Create a layer from each section. Copy the text from each section. i.e. each image is a layer, each text block is a layer, each text heading is a layer For reference-page1 should contain approximately 19 layers.
I'm in need of a talented designer who can create realistic mockups of various tables for my home decor line. Key Responsibilities: - Designing and creating mockups for tables - Ensuring the mockups are of high quality and look realistic - Providing a variety of designs that align with my brand Ideal Skills & Experience: - Proficiency in design s...Proficiency in design software such as Adobe Photoshop, Illustrator, or others - Experience in creating mockups, particularly for home decor items - A good understanding of my brand and design aesthetic - Strong attention to detail and ability to deliver high-quality, realistic designs %d7%a9%d7%95%d7%9c%d7%97%d7%a0%d7%95%d7%aa-%d7%a1%d7%9c%d7%95%d7%9f this is reference for the type of design I'm looking for
I'm in search of a skilled WordPress develope...personalised news media content and working with API content feeds is a must. - **WordPress Development Expertise:** Proficiency in WordPress development is essential. - **E-Commerce Skills:** Understanding of e-commerce functionalities and payment gateway integration. - **Marketing and Analytics Experience:** Knowledge of inbound and outbound marketing strategies, data collection (email addresses, cell phone numbers) and data measurement is required. You will need to be able to set and achieve traffic and revenue targets and earning comission and success fees as part of an on going contract renumeration. Need someone that wants to make a fair base hourly rate andcearn large success fees from traffic flow gains and sales in the...
...and managing stock, and facilitating seamless communication with our workshop. The application should include the following features: - Fleet Maintenance Organisation: An effective and user-friendly system to manage our service schedules and gather data on both maintained and pending cases. - Comprehensive Service Dockets: Tools to record detailed information on every job, including automatic cell population for standard information. - Stock Management: Features to keep track of tyres and other parts available in each of our service vehicles. - Reminder system: Identifiers to highlight upcoming work and parts requiring attention, ensuring our team is always prepared. - Location Tracking: Can track service trucks to optimize routes and service delivery. - Time Management &...
No AI generated art work please look at reference art projects will be rejected if it looks nothing like the character. High Elf Archer is a slender and tall elf with green hair that is long in the back and short in front, with two braids at the side. She has long ears that confirm her status as a High Elf. She wears a green sleeveless archer corset, shorts, a pair of uneven black gloves, knee high boots, and a hood. On adventures, she wears an additional black sleeve over her left arm, the arm guard for her bow arm. She is described as stunningly beautiful, even among elves. On several occasions, she is shown to take the immediate attention of males. She has a small bust, which she is sensitive over. High elf archer should be provocatively
No AI generated art work please look at reference art projects will be rejected if it looks nothing like the character. Priestess is a pretty young woman with long blond hair that is tied back in a small ponytail by a small blue bow with chest-length hair strands hanging on either side and blue eyes. She is usually seen wearing white robes over blue garbs, both laced with golden outlines and wielding a golden-colored staff decorated with blue jewels. Unseen, during adventures, she also wears protective chainmail under her garb. Priestess should be provocatively dressed and flirty but not over overly done to the point of pornogrophy More details: Is this project for business or personal use? Personal What information should successful
No AI generated art work please look at reference art projects will be rejected if it looks nothing like the character. Cow Girl is a young woman with rose-colored eyes and short red hair. Working on a farm since childhood has given her an athletic body. She is often seen wearing a long-sleeved shirt, black overalls, and black work boots. Cowgirl should be provocatively dressed and flirty but not over overly done to the point of pornography More details: Is this project for business or personal use? Personal What information should successful freelancers include in their application? Experience How soon do you need your project completed? Within 2 weeks
I am seeking a logo graphic designer to create two simple, text-only logos. Please see the attached example for reference. Key Requirements: - Expertise in minimalistic design: A strong portfolio showcasing previous work in minimalistic logo design is a must. - Versatility: Ability to create a design that looks equally good on both digital platforms and print materials, as well as scalable for merchandise. - Color expertise: The logo will predominantly be in white, however, I'd like a subtle touch of pink in one variation, and a touch of purple in another. Please provide samples of your previous work in similar projects.
...travelers. Style: The writing should be engaging, informative, and accessible, avoiding overly complex language. It should inspire curiosity and excitement about visiting Germany. Cultural Relevance: Include references or comparisons that are familiar to the Malaysian audience to make the content more relatable. Additional Information: We will provide an example article in German to serve as a reference for the style and structure we are looking for. You are encouraged to use this as a guideline but adapt it to suit the Malaysian audience. The successful freelancer may have the opportunity for future collaboration on additional content creation projects. Qualifications: Proven experience in copywriting or content creation, preferably with a focus on travel and tourism. Strong...
I am seeking a skilled logo designer to create a logo for my indie electronic music career. The brand name is BLB. All uppercase or lowercase works. I attached a reference logo that I like but feel free to be as creative as possible with it. Key Requirements: - Use a neutral color scheme to maintain a simple and do-it-yourself feel. - The logo must effectively interpret and represent the indie electronic music style. - The logo should instill a sense of simplicity and ingenuity Ideal Candidate: - Adept in creating visually compelling logos - Sensitive to the unique characteristics of different music styles - Experience in creating logos that demonstrate a do-it-yourself aesthetic.
I'm looking for someone who is smart and can record some action songs for preschool kids. No previous experience is required. You can just use your phone camera to record the videos. You only have to act/dance based on the songs we provide. You will get the payments for each video song you record. I will provide you with all the reference songs for each video. These are just 3-5 minute long videos and it depends on the rhymes song. Please take a look at the example video (This is just a demo video and the rhymes will be mostly in English.) -------------------- -------------------- -------------------- -------------------- -------------------- -------------------- -------------------- -------------------- PLEASE NOTE: You must be in SAREE for
I'm seeking a talented designer to work with us on a GIG or part time basis. We need you to revamp company's email branding Key Requirements: - Modern, clean design style - Incorporation of company logo, social media links, and contact information - Overall design and layout should be reflective of our brand - Se...your previous email branding work and explain how you would approach this task. You will have skills in using either figma, photoshop, canva or beefree PART 1 We have a 1 hour paid mock test for the right person If the design is really good We will invite you to PART 2 Then you will design it in the email system (make sure it works, layout is mobile optimised and dark mode etc) Future reference Generally, we award a gig that has a task of 10+ templa...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
I’m seeking a skilled developer to convert my existing PortVB Desktop App into an iOS/Mac Desktop App. It a small tool that runs on a Windows PC and reads some flat XML files and inserts/updates a mySQL database. We need the same program to be able run on a iOS/Mac desktop. I have all the VB Project files/ Source code. - Skills in app development for iOS/Mac, ideally with previous experience in app conversion - Knowledge of data syncing, user authentication, and offline access, in case these features need to be incorporated - Familiarity with contacts management, communication, scheduling, calendar integration, and file/document management functionalities for potential focus areas - Creative design skills to potentially revamp the user interface and overall design of t...
...of images in marketing, web, and print materials. Timeline: Photographer Qualifications: Proven experience in architectural and real estate photography. A strong portfolio showcasing similar projects. High qulity camera and lens. ataching example in this link in special for 72-01 Queens Blvd I need whole building shot , Ataching file with reference....
I need a modern and minimalist logo designed for my company, 1031 Cap Ex, to be used primarily in marketing materials. NOTES: - only the C and E should be capital like this 1031 Cap Ex - look at uploaded examples for style reference. do not copy. come up with a new logo that follows those styles Key Points: - The logo design should be clean and simple, reflecting a modern and minimalist style. - It will primarily be used on marketing materials, so the design should be versatile and scalable. - The target audience is sophisticated, so the logo should convey professionalism and trustworthiness.
Looking for someone to do full drawing set for gas station design. Must have previous experience. Please provide a previous project as reference when bidding.
I'm looking for a talented graphic designer to create a vibrant, 8k cartoon profile photo for my PUBG account. Key Requirements: - Style: Cartoon - The photo should be in a visually appealing, animated style. - Elements: In-game items - I'd like the photo to include some notable in-game items, which I will provide for reference. - Color Scheme: Bright and vibrant - The overall color palette should be lively and eye-catching. Ideal Skills and Experience: - Strong background in graphic design, with experience in creating cartoon-style artworks. - Proficiency in using design software to create high-resolution, detailed images. - Familiarity with PUBG or similar games to understand and accurately depict in-game items. Note: As the photo will be used as a profile pict...
Hello, I'm looking for a web developer to review and correct the structure of my project. The container, where all the site's content will be, should be 1100px and centered. The font hierarchy should also be corrected and the site should be responsive. In the files, you can see the reference of the main pages for desktop and mobile. It should also be applied to the pages of the three projects.
...enhance readability and draw attention to key areas. Print and Digital Versions: Provide print-ready files suitable for professional printing. Create a digital version that can be easily shared online or via email. Additional Elements: Include a cover page with our logo and a brief introduction to our company. Design a back page with contact information, social media links, and a call-to-action. Reference for Design Inspiration: We would like our pamphlet to have a similar professional look and feel to the maintenance plans pamphlet provided by Larson Air: Larson Air Maintenance Plans. Project Deliverables: Initial design mockups for review and feedback. Finalized design files in high-resolution PDF format for print and digital distribution. Source files in Adobe InDesign or ...
...need of a freelancer to assist with labeling text tweets by topic (to aid in machine learning research). Key Requirements: - Labeling 1,000 tweets as to whether they are about the topic sustainability - Must be labeled by hand (no machine learning or AI) by a native English speaker Task: -Open the attached spreadsheet -Read the FULL TEXT of each tweet. Also read the brand handle and sector for reference. Make sure to pay attention to any hashtags included. -You do not need to open any URLs. Make your judgment based only on the text. -If the tweet is about sustainability, enter "1" in column E. If it is not about sustainability, enter "0" in column E. -Note that "sustainability" is a broad topic -- it is often a judgment call as to whether a given...
...in my spreadsheet: Total Costs for the Job (Cell V14): $241,779.50 Total Collected (Cell V17): $289,844.00 Profit (Cell V15): Calculated as =V17 - V14, resulting in $48,064.50 I need to calculate the profit as a percentage of the total costs, and this should be displayed in cell V16. The formula I am using is: = ( ? 15 / ? 14 ) ∗ 100 =(V15/V14)∗100 Given the values: = ( 48 , 064.50 / 241 , 779.50 ) ∗ 100 = 19.88 % =(48,064.50/241,779.50)∗100=19.88% However, instead of getting 19.88%, the result I am seeing is 1987.95%. This suggests there might be an error with the data, cell formatting, or an unnoticed issue in the spreadsheet. Specific Tasks: Review the Spreadsheet: Analyze the provided Excel file to ensure all values...