Why vb is called event driven programming punët
projekyi qe un do te bje do te permbaje foto dhe muzik , ai do te quhet jeta eshte e bukur ose life is beautiful. ai do te et me slide dhe levizje te ndryshme ,
projekyi qe un do te bje do te permbaje foto dhe muzik , ai do te quhet jeta eshte e bukur ose life is beautiful. ai do te et me slide dhe levizje te ndryshme ,
projekyi qe un do te bje do te permbaje foto dhe muzik , ai do te quhet jeta eshte e bukur ose life is beautiful. ai do te et me slide dhe levizje te ndryshme ,
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
pls ignore jjjvcxjvjxcjxj xvjuhfsvmxnvmxvnx xvkjxnvkjxcnvxjcnv xnxkjvnxjvnx shuhw fhsufsdf fushufs fsdf
sjdbsliafhi'oqwja'nc;abjsfpwquhfajdaop'ndowbf9[whd9qjdop'adnABJFP9fhjwqo]jFSO;ABFI[GFHW9QiAJDPN;ASbfdpUHF
12 358545054650090 111rt566ugu88hgr33edgi8onknfrxdsa45g78hvjutxcesyibboonngrexcsq13rfgyujhjiijnp0086yv54effewrrd6yviijbutfc4211r9u6gg4yvubgdwasvcrvh9onkppnh6y
12 358545054650090 111rt566ugu88hgr33edgi8onknfrxdsa45g78hvjutxcesyibboonngrexcsq13rfgyujhjiijnp0086yv54effewrrd6yviijbutfc4211r9u6gg4yvubgdwasvcrvh9onkppnh6y
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
...developer who can help with an important task -- Macro Programming. The main purpose of this programming will be to improve the output of data in a more coherent and meaningful way. Here's what the project involves: - Macro Programming: I am specifically looking for someone who can build macros in our system to ease the process and make it more efficient. - Data Output Formatting: The second important part of the task is to navigate data output formatting. Even though I haven't specified the kind of formatting, this is a crucial aspect of the job. Skills and experience necessary for this project include: - Proficiency in VBA development and Macro programming - Experience in managing and manipulating data - Skills in data output ...
I am in search of an experienced SEO professional to help my website gain more visibility and increase lead generation. Key responsibilities: - Develop a comprehensive SEO strategy to enhance website traffic, search engine rankings, and lead generation - Implement on-page optimization techniqu...changes - Regularly monitor, report, and adjust SEO campaigns for optimal performance Ideal skills and experience: - Proven experience in SEO management with a track record of increasing website traffic, search engine rankings, and lead generation - In-depth understanding of on-page optimization and technical SEO - Excellent analytical skills to measure effectiveness of SEO strategies and make data-driven decisions - Strong communication skills to provide regular updates and collaborate e...
...Australian based The main tasks include: - **Interactive Forms Implementation:** The developer should be able to create interactive forms that are user-friendly and smoothly integrate with our current web page. This will involve a combination of design and programming skills to ensure a seamless user experience. - **Shopify Linking for Event Ticketing:** The main function that needs to be implemented is a robust ticket sales tracking system. This will involve setting up a connection between our web page and Shopify, ensuring that ticket sales data is accurately tracked and reported. Ideal skills and experience for this project include: - Proficiency in HTML/CSS and JavaScript. - Previous experience in creating interactive forms. - Experience in integrati...
...flat patterns needed for manufacturing - Setting up configurations and global variances for sizes, materials, and thicknesses Moreover, the final goal is to establish a DriveWorks automation project. I'm looking for someone to ensure it encompasses: - A customizable user interface for parameter input - The ability to automatically generate reports or documentation I need this project to be completed as soon as possible. Ideal candidates should have a strong background in Solidworks, with extensive experience in sheet metal panel design and DriveWorks automation. The ability to work swiftly and efficiently, particularly under tight deadlines is a must. I would estimate about 20 or so panel types with each having 2-4 different materials and 2-4 different thickness...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
I'm seeking a skilled PLC programmer to develop a timed sequence for pneumatic valves used to operate four dampers in a wave pool. This PLC program aims to control the intensity of the waves. The functionality should include: - Sequential opening and closing of the dampers - Pneumatic valve control via PLC interface Ideal skills and experience: - Significant experience in PLC programming - Understanding of pneumatic valve control - Knowledge on wave pool operation preferred - Ability to optimize for energy efficiency and performance - Problem-solving and analytical abilities to troubleshoot and improve system functionality. This challenging task calls for a solution-oriented mindset and innovative thinking. Increased wave control will result in a more engaging and enjoya...
...for our website. Every month, we'll be needing new artists & posts added, our events info updated, and other tweaks & updates to be made current. This is an ongoing project and would ideally suit someone who is passionate about the arts since we're a nonprofit in that niche working at the intersection of music and service. This is an ongoing role, but to start only about 2 hours a month of work will be required. Key tasks include: --Monthly updates - publishing blog posts - Updating event data and artist roster as well as hospital listings --Connecting socials with website A solid understanding and proficiency in Wordpress and Divi is necessary for this project. Previous experience or a strong interest in arts-related initiative...
...Primarily, I want the alerts to be sent to my email & in trading view platform. This is essential for me to act promptly on the trading signals. - **Trading View Integration**: The program should be compatible with Trading View. This is the platform I prefer for analyzing markets and executing trades. Strategy need to work in all the time frame. So code based on it. 1. 2 Heiken ashi candle with increase in price and volume to be alerted. Ideal Skills and Experience: - Proven experience in developing for Trading View is a must. - Proficiency in programming languages and tools related to Trading View. - Previous experience with integrating programs with email services for alert delivery. I appreciate a programmer who is responsive and can communi...
I’m seeking a skilled developer to convert my existing PortVB Desktop App into an iOS/Mac Desktop App. It a small tool that runs on a Windows PC and reads some flat XML files and inserts/updates a mySQL database. We need the same program to be able run on a iOS/Mac desktop. I have all the VB Project files/ Source code. - Skills in app development for iOS/Mac, ideally with previous experience in app conversion - Knowledge of data syncing, user authentication, and offline access, in case these features need to be incorporated - Familiarity with contacts management, communication, scheduling, calendar integration, and file/document management functionalities for potential focus areas - Creative design skills to potentially revamp the user interface and overall design of t...
ACDP is an enterprise and on the lookout for a skilled IT professional to help bring a variety of projects to life. The scope is broad, encompassing possible website development, software creation, or app building initiatives. **Initial Requirements:** conversion and enhancement of a Codeigniter-based website to WordPress. DNS Security configuration. Addition of webpages, design and functionality as per a chosen template. - **Past Work:** Showcase similar projects you've spearheaded or contributed to significantly. Links or a portfolio will be highly beneficial. - **Experience Level:** I'm targeting someone with an intermediate level of experience. You should have a solid track record and be comfortable tackling the complexities of IT development without needing...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
I have a brand called "Glacier" and I am in the process of creating and registering a gastronomic type product, it is empanada tapas I saw a packaging format that I really liked, and I think the idea could be from there, this packaging belongs to one of the competitors, so the idea would be to use that format, but dress it with a design according to my logo. I am attaching some files to show the idea. - Logo of my brand: "" - Box I got from the competition: all "competition packaging....jpg" files - This is how the product looks like: "product example*.png" - This is how the prodcut looks after cooking: "cooked product example*.png"
I'm in need of a Java developer with expertise in debugging issues related...files in a runtime environment. Key Requirements: - Your primary task will be to troubleshoot why my application, which updates the properties file during runtime, fails to reflect the updated values when reading. - The updated properties should ideally be reflected periodically within the application. - The purpose of updating the properties file is to store user preferences. The ideal candidate should have: - Proficient experience in Java programming. - Strong understanding of how to work with properties files. - Proven skills in debugging and troubleshooting. It's important for the candidate to be able to work independently and swiftly identify and rectify the issue. Efficient ...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
...integration of key system components within our e-commerce platform. The successful candidate will lead initiatives to enhance user interactions by developing a WordPress plugin, building a robust .NET middleware API, and integrating advanced Azure-based messaging services. Additionally, the role involves creating an SDK to facilitate easy integration for third-party AI bot services. This position is crucial for ensuring that our platform not only meets current technological standards but also adapts to future advancements and user needs, enhancing both the scalability and functionality of our services. Responsibilities: WordPress Plugin Development - Design, develop, and maintain a WordPress plugin that integrates the WordPress frontend with the .NET-based middleware, enhanci...
I'm seeking a talented software engineer with expertise in both frontend and backend development, specifically using Java, for a greenfield project to build a new application. Key Responsibilities: - Develop the frontend of the application, ensuring high performance and responsiveness to requests - Design, imp...strong understanding of its ecosystem - Possess a solid background in frontend technologies, such as HTML, CSS, and JavaScript - Be familiar with software design patterns and have experience with databases and data storage solutions - Have excellent communication skills, able to work effectively in a team and clearly articulate technical concepts to non-technical stakeholders. If you're a results-driven individual with a passion for software engineering, I'...
...Expert in low-level programming, specifically in system-level assembly language. Knowledgeable in gaming input emulation and keyboard input simulation. Experience in backend applications is beneficial. Project Specifics: The emulator must not breach game firewall securities or require unauthorized system modifications such as disabling driver signature enforcement. It should operate successfully in the game, similar to devices like Arduino Leonardo or ESP32. The goal is to simulate pressing the Z1 keys solely through software, without external devices. Activation should be tied to the Caps Lock LED status—active when on, and inactive when off. Solutions utilizing 'keybd_event' and 'SendInput' do not meet the requirements of this project; a...
...for this project: - Create an AI-driven text model: I need a text model that is capable of engaging in intelligent dialogues. This means understanding context, providing relevant and meaningful responses, and exhibiting emotional intelligence. - Incorporate emotional responses: The text model should be capable of expressing emotions and feelings in a realistic manner. This is crucial for creating a believable and engaging virtual girlfriend. - The model can be trained from scratch or, if you have knowledge of current models, adapt it to your needs. - The person must know how to configure the backend of the model to limit illegal content or prohibited dialogue contexts. Ideal skills and experience for this job include: - Proven experience in developing AI-driven...
I'm looking for someone to help me create a list of 2000 business contacts from specific websites, particularly names, company names, position, location information, event information, number of events, current events, past events in 2024, and email addresses. I would like this list to be compiled through online research only. Key responsibilities: - Researching and compiling a list of business contacts - Ensuring all email addresses are verified and duplicates removed. Note: The focus should be on getting accurate, up-to-date information.
I am looking for a freelancer who's experienced in creating Klaviyo email campaigns for my existing customers. Our goal is to increase sales through an effective email campaign funnel. Key tasks include: - Crafting engaging and sales-driven email content - Designing and building the email funnel to maximize customer engagement and sales conversion Ideal Skills and Experience: - Proven experience in using Klaviyo for email marketing campaigns - Strong track record of crafting sales-driven content - Familiarity with customer retention strategies - Background in our industry is a plus Looking forward to working with a highly skilled email marketer who’s able to drive our sales goals.
...Input Data: The input data is in JSON format. - Output Data: The JSON output should be properly formatted and adhere to a specific schema or structure. Skills and Experience Required: - Proficiency in Python programming. - Strong understanding of JSON parsing and formatting. - Experience in adhering to specific JSON schemas or structures. Please let me know your experience in similar projects and any relevant information that would make you a strong candidate for this job. You will pass the name of the input file as an argument and the output file should be the same file name with the .output extension. The input file is attached. Pay attention to the backslashes ("") that make it non-compliant. All the elements to need to be structured correctly. ...
I'm looking to transform a dramatic and inspiring piece of poetry into a captivating 2D animation. The story should be driven by the animation and text - a voiceover is not required. The animation will serve as a visual narrative, engaging viewers through vibrant, energetic visuals. Key requirements: - Experience in 2D animation, specifically in storytelling. - Ability to perceive and translate the mood and tone of the text into the animations. - Understanding of typography and text animation, to integrate the poem seamlessly with the visuals. - Appreciation for poetry and its nuances would be beneficial. Your ability to bring words to life via animation is instrumental for this project. Let's create a piece that encapsulates the lively and uplifting spirit...
...general consumers. Key Responsibilities: - Strategizing, planning, and executing PR campaigns across different platforms, including social media, traditional media, and through event sponsorship. - Building a positive image of our brand and fostering a strong relationship with general consumers. Ideal Skills: - PR Management - Social Media Marketing - Crisis Management - Event Sponsoring - Media Relations Your proven skills and experience in PR strategies targeted at general consumers will be crucial. Expertise in various platforms, especially social media, traditional media, and event sponsorship is essential. The ideal candidate should possess significant experience in managing PR in diverse environments and a track record of improving brand r...
I'm in need of a proficient web designer who can help ...attendance for our events. - User-friendly interface: Ease of navigation is crucial. Visitors should find it easy to explore our upcoming events. - Robust features: The website should enable promotional activities such as ticket sales, event schedules, event descriptions, and a gallery for previous events. Required Skills: - Experienced in web development and design - Proficiency in using CMS tools and SEO - Experience in working with event-related websites is an advantage. I look forward to seeing high-quality portfolios that showcase your style and expertise. Please include relevant links in your proposal. Time efficiency and cost-effectiveness will be factors in my decision. Let's cr...
...tailored to reach local customers. This role requires a keen understanding of how to effectively drive lead generation. Specific responsibilities include: * SEO: Optimize my website's organic search rankings to improve lead generation * Social Media Management: Craft and execute a strategic social media plan to connect with the local customer base * Email Marketing: Develop a captivating and result-driven email campaign The ideal freelancer: * Experience with SEO, social media management, and email marketing * Proven track record of lead generation * Understanding of local market demographics and trends * Strong analytical skills to track success and pivot strategies as needed * Highly creative in developing engaging and innovative marketing strategies. Take your digital...
I'm seeking a freelancer with skills in either ESP8266 or ESP-NOW. The project involves integrating a reed switch and relay with two ESP8266(D1 Mini) devices. There's one transmitter and a gateway that communicates with a local Mosquitto. Here's what yo...either ESP8266 or ESP-NOW. The project involves integrating a reed switch and relay with two ESP8266(D1 Mini) devices. There's one transmitter and a gateway that communicates with a local Mosquitto. Here's what you'll mainly be doing: - Setting up the reed switch to trigger an event. - Ensuring that event sends a message via the gateway to Mosquitto. Experience with IoT technologies, particularly reed switches, relays, mosquitto and wireless communications would be ideal. A good understanding ...
...need any experience whatsoever, but you must be clever and eager to learn. No. I am *not* being charitable; rather, I am being practical. ✻ PAYING YOU TO LEARN ✻ No. You aren't dreaming. I value intelligence and problem-solving ability over experience. I'd prefer to work with someone who is clever and learns quickly rather than someone experienced but is not very intelligent and/or does not solve problems scientifically. Would I hire an Isaac Newton or an Albert Einstein even if he had no programming experience? Of course I would. ✻ TESTS ✻ You must pass several difficult logic tests to work with me. The first logic test you complete for me will be an unpaid logic test. In other words, I would not pay you any money whatsoever if you were to pass the...
I'm in need of a modern logo that will represent my event decorating company based in sunny South Florida. THE NAME IS “BOUNCE N’ PARTY” - Specializes in birthday and corporate events - The logo should exude a modern aesthetic - Avoid any childish imagery - Open to having subtle hints of pink - The logo should be versatile enough to be used across various mediums and sizes No water colors Submit ICON, no abstract features Vibrant but not childish
I'm looking for an expert developer who's proficient with AWS ...Shopify - Routing these events to either SQS or Lambda Your primary task will be to ensure that Shopify webhooks are efficiently processed through AWS EventBridge. Ideal skills and experience for this job: - Proficiency in AWS services, especially EventBridge - Experience with Shopify webhooks - Knowledge of server setup and configuration - Prior experience with middleware systems and large volume event handling - shopify graphql and restful api Please note that while the user hasn't specifically outlined the action to be taken upon receiving the webhooks, it's expected that you'll be able to advise on the optimal setup for further processing of these events. Please note: currently, I using...
I am looking for an experienced CNC programmer to help me program M codes on my Syntec 60W-e CNC controller. I have 3 unused out relays that I want to use, and I would like each of them to be assigned to specific M codes. Here’s what I need: - Assign M code e.g. M30, M50...program M codes on my Syntec 60W-e CNC controller. I have 3 unused out relays that I want to use, and I would like each of them to be assigned to specific M codes. Here’s what I need: - Assign M code e.g. M30, M50 and M80 to the unused output relays. - The function they should perform is to turn an external device on/off. Skills and Experience: - Previous experience with CNC programming is crucial. - Familiarity with Syntec 60W-e CNC controller will be highly advantageous. - Proficien...
I'm seeking an expert in Python for a Natural Language Processing project focusing on text classification of social media posts. Key Project Features: - The goal is to build a Python coding notebook that can efficiently classify different types of text within social media posts. This will require a deep understanding of NLP principles and techniques. - The project primarily demands the use of Python for its implementation. Ideal Skills and Experience: - Expertise in Python programming is a must. - A strong background in NLP, particularly in the area of text classification, will be highly beneficial. - Prior experience working with social media text data would be a plus. If you're confident in your Python and NLP skills and have experience in text class...
We are seeki...anti-scraping measures like CAPTCHAs, rate limiting, and IP blocking. Ensure data scraping processes comply with legal and ethical standards. Troubleshoot and resolve any issues that arise during scraping operations. Collaborate with our development team to integrate scraping solutions seamlessly. Requirements: Proven experience in web scraping and data extraction at scale. Proficiency in programming languages commonly used in web scraping (e.g., Python, Node.js). Experience with cloud services (AWS, GCP, Azure) and deploying scalable scraping solutions. Advanced understanding of web security measures and techniques to bypass them. Strong problem-solving skills and the ability to work independently. Excellent communication skills and the ability to document processe...
I'm in urgent need of a creative and professional designer who can quickly design a medium-sized roll up banner (80cm x 200cm) for a sharktank presentation. Your responsibility will include highlighting the sharktank event announcement in a compelling and attractive manner. Ideal Skills: - Proficiency in graphic design software - Experience in designing banners, specifically for events - Ability to deliver high-quality work promptly The project needs to be completed as soon as possible, so I need someone who can start immediately. --- Ignite your senses Neuroplay logo Large neuro play written across More pink More purple QR Code white drop --- Fully editible format to add QR code later on my side Attached a design I like Attached neuroplay logo
...experienced programming teacher who specializes in both Java and Python. I'm seeking advanced-level guidance, mainly through the following: - One-on-one mentoring: You will provide personalized, in-depth insights catered to my capacities, skills, and learning speed. We will explore challenges and complex concepts together. Patience and exceptional communication are crucial. - Expertise in Java and Python: You must demonstrate a solid understanding and practical application of these languages in the industry. Exit profiles such as the development of complex systems, application in advanced artificial intelligence, or extensive backend management would be ideal. - Advanced Level Programming: I need a tutor who can help me comprehend and implement advanced aspects o...
I need a unique and creative Pokemon style logo designed for my non-profit organization called "pokegive". The logo should embody the charity's mission, which is centered around donation of pokemon cards for kids in need in hospitals or anywhere in the world. I would like the design to include a pokeball and incorporate the colors red and white or the pokemon logo colors. Ideal Skills and Experience: - Graphic design with a strong portfolio of creative, unique logos - Familiarity with the Pokemon aesthetic and style I am thinking of the words POKEGIVE wrapped above a pokeball. 'Poke' written in the pokemon logo and 'Give' in white (example). You could also have a variation with poke above the pokeball and give below it all wrapped follow...
...calculation in my Excel spreadsheet. Despite following standard procedures, the result is incorrect, and I need assistance to identify and correct the problem. Details: I am working with the following data in my spreadsheet: Total Costs for the Job (Cell V14): $241,779.50 Total Collected (Cell V17): $289,844.00 Profit (Cell V15): Calculated as =V17 - V14, resulting in $48,064.50 I need to calculate the profit as a percentage of the total costs, and this should be displayed in cell V16. The formula I am using is: = ( ? 15 / ? 14 ) ∗ 100 =(V15/V14)∗100 Given the values: = ( 48 , 064.50 / 241 , 779.50 ) ∗ 100 = 19.88 % =(48,064.50/241,779.50)∗100=19.88% However, instead of getting 19.88%, the result I am seeing is 1987.95%. This suggest...
I need an expert to transfer my TeamUp calendar to while maintaining the current color coding and sub-calendar structures. Key Requirements: - Migrate TeamUp Calendar to - Preserve existing color coding - Maintain sub-calendar structure - Ensure event descriptions are carried over accurately Ideal Skills: - Proficiency with TeamUp and - Experience in calendar migration - Understanding of color coding and sub-calendar maintenance - Attention to detail in data transfer Please let me know your experience with similar projects and provide a proposal for the migration process.
NOTE: MUST SUBMIT AN ACTUAL HIGH-LEVEL STRA...to our target audience. - This strategy should emphasize: - Brand awareness - Generating website traffic - Driving bookings and reservations. 2. Marketing Channels: - I would prefer a focus on: - Social media platforms - Local event partnerships - Online advertising Skills & Experience: - Proven track record of developing and executing successful marketing strategies. - Experience in targeting similar demographics. - Strong understanding of social media platforms, online advertising, and local event partnerships. - Background in the travel and leisure industry would be a plus. If you have a knack for creative marketing strategies and can help us make our RV date nights a success, we...
I'm in need of a professional and well-rounded computer programmer to build and manage various software applications. Key Tasks: - Develop innovative web and mobile applications - Manage and maintain the software database Ideal Experience and Skills: - Strong familiarity and skill in programming languages (Java, Python or C++) preferred - Previous experience in database management - Proven track record in developing web and mobile applications While skills in Java, Python, and C++ are a bonus, I'm primarily interested in your ability to perform the tasks specified above. Show me what you've got!
