Airline reservation project asp net vb punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
Project to create a digital memorial (mini social network) platform for people to honor their loved ones. Our prototype is ready, and we'll develop it using C#/.NET for robustness and scalability. Link to website prototype: (Copy)?type=design&node-id=0%3A1&mode=design&t=jfwDURBhWcI72r1x-1 You don't need to strictly adhere to the prototype design; it's meant to showcase the elements within it.
I'm in need of a unique plastic rectangular frame with a net for a beach game. The net will be used for a game similar to spikeball that will be played on the beach. It is similar to a a game called beer dye commonly played at colleges so I need to have 4 holes in each corner that can hold a ball similar to how poole is played where the balls fall in a hole Key requirements: - The frame should be durable, water-resistant and suitable for the beach environment. - The net should be of high quality and appropriate for game play. - The overall design should be innovative and engaging. The ideal freelancer for this project would have experience in: - Industrial design with an emphasis on sports equipment or outdoor products. - Fabrication of plastic ...
I'm looking for a skilled developer to optimize my .NET and Angular project. The main areas I need improvement in include: - Performance: The project currently suffers from slow loading times. I'm looking for a professional who can optimize the code to ensure faster loading speeds. - Code Structure: The backend code in particular requires attention. I want to restructure it for better readability and maintainability. - Routing and API Optimizations: I need someone to optimize routing and API calls to decrease loading times and improve overall project performance. -Lazy Loading, Eager Loading optimizations Ideal candidates will have: - Proficiency in .NET and Angular - Experience with optimizing projects for performance, especially in addressing...
...Required: Availability from 9a-5p EST on 5/13 and 5/14, ability to make ~500 domestic calls from US cell phone/number. Key Responsibilities: - Conduct a series of cold calls to to pool service companies to collect data on their business statistics (size, etc.) and software usage (offering $USD incentive for participation) - Collect feedback on which specific Swimming Pool software they use, Net Promoter Score (NPS), Likelihood to Switch to a different software platform, etc. - Document the feedback accurately in Google Sheets - Schedule interviews via Calendly (offering $USD incentive for participation) Ideal Skills and Experience: - Background in US telemarketing - Previous experience in conducting cold feedback phone calls - Strong communication skills - Attentio...
...experienced .NET developer to help me build a cloud-based web application. I haven't settled on a specific type of database yet, so I'm looking for your expertise to guide me in selecting the most suitable option. The application should be developed using .NET Core and should include a Web API. Key Requirements: - Database Selection: I'm currently undecided about the type of database to use for the application. Your input in selecting an appropriate database will be much appreciated. - User Authentication: I would like the application to have user authentication capabilities, preferably integrated with popular social media platforms. - User Management: The web application should have user management functionalities. The ideal candidate for this project...
...looking for a front-end developer to assist in building a reservation system for a trampoline park, which consists of: - POS system - Website - Website displayed on tablets for customer registration The project is based on the following technologies: - Single Page Application - The backend is written in Django (DRF) and PostgreSQL - Microservices architecture based on Docker and Docker Compose - GIT - CI/CD Requirements: - Good command of English - Ability to write clean, bug-free, and scalable code - Minimum 5 years of experience in building web applications - Very good knowledge of and React - Excellent communication skills Nice to have: - Knowledge of Polish or Spanish language - Knowledge of Python / Django The project is expected to last for several months...
...Sheets. Required: Availability from 9a-5p EST on 5/13 and 5/14, ability to make ~500 domestic calls from US cell phone/number. Key Responsibilities: - Conduct a series of cold calls to to pool service companies to collect data on their business statistics (size, etc.) and software usage (offering $USD incentive for participation) - Collect feedback on which specific Swimming Pool software they use, Net Promoter Score (NPS), Likelihood to Switch to a different software platform, etc. - Document the feedback accurately in Google Sheets - Schedule interviews via Calendly (offering $USD incentive for participation) Ideal Skills and Experience: - Background in US telemarketing - Previous experience in conducting cold feedback phone calls - Strong communication skills - Attention t...
I'm seeking a talented developer to create a flight booki...MongoDB & Prisma), only a small part of it is ready (not much around 25% done so far), initially the current code needs to be checked, fix bugs and develop the project The project is a flight booking site, Here's what the project entails: - Development of an AI-driven flight search and booking platform - To be exclusively used in a web format - Priority is quick project completion, as I need this done ASAP Attached are the specific tasks required Sigma design is ready and beta site is online Ideal skills and experience: - Proficiency in AI technology - Extensive web development experience - Previous work in the travel or airline industry would be a big plus - Ability to wo...
As a frequent user of...This software should be specifically developed for Windows users. Ideal skills and experience for this project include: - Development of booking or reservation applications. - Proficient experience in Windows-based software development. - Understanding of payment gateway integration. In terms of the user interface of the software, I would appreciate it being customizable and user-friendly. This will ensure the software can cater specifically to the needs of various users, both new and experienced. Therefore, an aptitude for designing intuitive, customizable software interfaces is a great advantage. I look forward to seeing your proposals and start working on this interesting project soon! Ie Software list You can copy the all script
...written in both JavaScript and .NET. This is a niche project where you'll be integrating the test suite into Jenkins for a continuous integration pipeline. Key Responsibilities: - Create robust Selenium tests for my applications, utilizing both JavaScript and .NET - Integrate the Selenium testing suite into Jenkins for continuous integration - Run tests efficiently and effectively in the pipeline - Identify and rectify bugs in the code before deployment Ideal Candidate: - Proficient in Selenium and JavaScript, as well as .NET and Maven - Prior experience integrating Selenium tests with Jenkins for continuous integration - Adept at identifying and fixing bugs in code - Strong communication skills, as you'll be part of the development te...
I'm in need of a talented and reliable developer who can implement a machine learning model in .NET Core for a simple time series prediction task. Key Requirements: - You'll need to utilize machine learning techniques to create a model capable of predicting daily /hourly visitors as we have data for each enterance. - The model must be suitable for .NET Core and efficiently integrated into the existing system. Ideal Skills and Experience: - Proficient in .NET Core - Strong understanding of machine learning algorithms, particularly those suited for time series prediction. Please note that the specific machine learning algorithm to be used was not specified, so you'll need to have a versatile understanding of various algorithms. Your ability to work ...
Hi. I need help to setup the binding for a RichTextBox .NET Control so that data is retained. There may be use of VBA that is needed. This is within a FactoryTalk View SE version 14 application. I don't know .NET or VBA, I am a FactoryTalk guy though. Example use case: Lets say a factory has 100 valves. If a user opens popup for Valve #3, I need a text box field in that popup for the user to enter data, and then data is preserved/saved. That popup should be one common FTV display that references the Valve_# that was selected (using parameter files, or...). This example is the main objective. I need a simple and easy solution to this, and I need to understand how to do it myself afterwards. This is perhaps a 1 hour job. My name is Marc. I'm ready to s...
I'm in need of an experienced developer who's well-versed in ASP.NET and VB.NET. The project involves the event pages i need where user can login and acess the event throught calender with specific functionality.. i will share feature to slected one ... Ideal Skills and Experience: - Proficiency in ASP.NET & VB.NET is a must, with a proven track record of projects involving user authentication and database integration. - Strong understanding of SQL Server databases and how to effectively integrate them into a .NET environment. - Experience in implementing user authentication systems that cater to both roles and individual accounts. This project requires a developer who can deliver secure and efficient user authentication and database integration funct...
I'm seeking an experienced C# developer to port a python webapp app to a C# web app (most likely ASP .NET with RazorPages). There is no database, all the data comes from an existing API. Key Skills & Experience Required: - understanding the fastapi + jinja templates (python based) - Hands-on experience in developing RESTful APIs using C# - simple and clean code - data serialisation The entire app has 100 lines of code + ca 100 lines of HTML template There are 3 buttons and about 6 endpoints Task: GIVEN: A simple webapp in python (fastapi + jinja) RESULT: - A webapp with the same functionality based on C# - it should be easy to understand / clean code - data serialisation as in the python app / template - short documentation (dependencies/install/deploy) ...
I'm looking for a skilled developer to change and develop an existing Hebrew language learning website, based on C sharp. Dot net. MVC. - The website is primarily focus on teaching the Hebrew language . - It should have interactive language exercises and grammar lessons. Ideal Skills: - Proficient in web development on C sharp. Dot net. MVC..
MUST READ FIRST =============== MUST HAVE - Blazor experience of at least 3 years - Latest version of .NET & SQL Server - At least 1 hour of availability between 6:00PM and 11:00PM EST - Your price is the one that you REALLY want to have with 10% +- NOTE - APIs will be provided (you will not develop APIs) - No development will be done on My Computer. - DO NOT APPLY if your fees can exceed 10% or your bid PROJECT I have C# Blazor Web App that works using SQL Server Database & using APIs at the same time. For the functions that use the database, I want to replace them with the APIs 1- Make code debuggable. 2- Error message appear with no details, need to make the error message has Show More to display the details of the error. 3- Load Codes from APIs instead of...
...Azure hosting. We run two .NET based sites on a single Azure instance - they are: We have control of the domain, but need to work with our client for control of the subdomain. We will purchase a multi-domain Comodo SSL certificate from NameCheap (potentially a new PositiveSSL Multi-Domain certificate again) and have you activate it and install it on the Azure service. The current SSL is due to expire on the 28th May 2024. Key Requirements: - Install the SSL certificate on an Azure instance hosting my two .NET sites. - Ensure that both sites are configured to run with HTTPS. The ideal candidate for this project should have: - Proficiency
...a developer experienced in .NET Core and Umbraco to make modifications to an existing Umbraco project. The main focus will be on changing the CSS and the Free Trial form, which needs to be integrated with a CRM system. Key Requirements: - Proficiency in .NET Core and Umbraco - Skilled in CSS customization - Experience with CRM integrations - Understanding of user authentication in Umbraco The main tasks include: - CSS changes to improve the overall look and feel of the site - Customizing the Free Trial form, particularly: • Layout and design adjustments • Integration with a CRM system for effective lead management Your expertise in Umbraco components, particularly in navigation menus, contact forms, and image carousels, will be beneficial for this ...
I'm starting a business in the financing/lending industry specifically around Exotic and Collector Cars. I need a comprehensive ...Required: - Market size and growth potential - Competitor analysis - Customer demographics and preferences Target Audience: - High net worth individuals - Car enthusiasts - Exotic car dealerships Ideal Freelancer: - Proven experience in market research and TAM analysis - Specific experience within the automotive or lending industry would be a plus - Ability to synthesize data and provide actionable insights - Understanding of the dynamics and trends in the exotic automotive market - Strong analytical skills and the ability to present complex data in a clear and concise manner Please reach out if you're confident in your skills to und...
I am seeking a skilled .NET developer to create a Windows application with the following features: - User Authentication and Authorization: The application should ensure secure user access and have roles-based permissions. - Database Integration and Management: Experience with handling complex data and ensuring its security is essential. - API Integration: The application needs to communicate with external systems through APIs. My primary concern is scalability. The application must be designed to grow and handle an increasing number of users without compromising performance. Hence, I am looking for a developer who can plan and implement a scalable architecture from the very beginning. The ideal candidate should have: - Proficiency in .NET framework, particularly for Windo...
I'm looking for an SEO expert to significantly increase the organic traffic to my websites. The...industry, is highly desirable. - Proficient in conducting keyword research and analysis. - Proven track record of increasing organic traffic and improving search engine rankings. - Familiarity with SEO tools like SEMrush, Moz, or Ahrefs. - Strong analytical skills to monitor and report on the performance of SEO strategies. Target Audience: - Businesses interested in offshore financial solutions - High net worth individuals seeking wealth management services - Individuals looking for offshore banking and company formation If you have a solid background in SEO, particularly within the financial services sector, and can help boost the visibility and sales of my websites, I'd lo...
I require an experienced developer to upgrade my ComicBase Mobile app, currently running on Xamarin, to .Net Maui. The app is utilized on both iOS and Android platforms. Key tasks include: • Deliver full conversion from Xamarin to the latest .Net Maui framework • Replace the current ZXing barcode library • Determine and implement a suitable alternative barcode library like , or others that meet my project specifications (refer to the attached requirements) - Add lesser fixes and update requirements (see attached) • Ensure compatibility across both iOS and Android platforms The ideal candidate should have: • Extensive experience in Xamarin and .Net Maui • Deep understanding of barcode libraries • Proven track ...
I'm seeking a skilled database developer to help me successfully migrate my database from .NET Framework 4.8 + EF6 + AspNet Identity to .NET 6 + EF Core + Identity. The database size is small - less than 1 GB, but it's crucial that user data is meticulously preserved during this transition. Key Tasks: - Perform data migration without any data loss. - Ensure the user login system and roles functions seamlessly in the new system. Ideal candidate should have: - Proven experience in .NET Core and EF Core migrations. - Strong attention to detail, particularly regarding user data. - Proficiency with user login systems in a .NET environment. Attached is the project source.
Hello I need an experienced programmer willing to take a project that requires attention to detail and precise understanding of the subject matter. I can give extensive details about the ideal functioning of the spreadsheet I need done, however, this is an overwview: Track all gross/net profits track all account balances track all bank balances track all ongoing and completed bets on each account track across futile types of bet single and sequenced (this will require custom logic) as well as more basic things. im looking of a single place for everything to happen and for the right person to create it. No work will need to be done with external API this is only an internal management and accounting system.
Se debe mantener un sistema hecho en .Net el cual esta vinculado a una base de datos SQL Server de Microsoft. El postulante debe manejar a la perfeccion el idioma Español.
I'm seeking a skilled .Net developer to assist in developing a comprehensive retail system that has features such as user authentication and authorization, inventory and product management. Requirements: - Proficiency in C#, .Net, Entity Framework and SQL Server - Ability to develop a retail project from scratch - Strong understanding of user authentication and authorization - Experience in inventory management and product cataloging It's crucial that the chosen freelancer has prior experience in building online retail systems and a strong understanding of the retail business model. The ideal candidate should be able to deliver a secure, efficient and scalable retail project. Any experience with Angular/react/Node would be plus
I require a developer with expertise in integrating payment gateways into WordPress websites. The project involves adding ICICI's complete suite of payment options including Net Banking, Credit Card processing, Debit Card processing and UPI to my two website. This integration is critical for the collection of membership fees on my website. Required Skills and Experience: - Solid experience with WordPress Web Development - Strong knowledge of ICICI Payment Gateway - Experience with integrating multiple payment options - Expertise in ensuring safe and secure payment transactions. I am currently using PayU and want to change it
I'm in need of a professional who is experienced with Microsoft Azure and can assist me in deploying a .net framework webform application as an azure web app
...secure, and maintainable code. - Excellent teamwork and communication skills, as this project will require close collaboration. Dev team required to develop a recruitment related web application for desktop and phone (design to completion) Whereby; candidates can create a profile upload their CV, images or link to images and videos recruiters can search CVs with a Boolean type search functionality & save searches. Candidates and recruiters can message each other. Admin can manage the back end. Suggested technical skill set but not a complete one… • Cloud-based server solution • Azure or Single server solution • MS SQL Database (NoSQL document database might be more appropriate?) • OAuth • Payment gateway • .net We suggest des...
- Project Description: Redesign a booking website, focusing on a streamlined user experience with an emphasis on the color blue. Ensure the site is user-friendly, easy to navigate, and fully mobile responsive. - Technical Requirements: Expert understanding of web design principles that optimize user experience and conversion rates. Experience with integrating and securing payment gateways. Knowledge of implementing search features with filters for different categories (e.g., boat types and locations). - Functional Features: Comprehensive booking system accommodating multiple boats with a search feature, supporting boat type and location filters. Secure payment gateway for credit and debit card transactions. High-quality, captivating visuals for the homepage featuring the boats (...
I'm seeking a seasoned .Net developer with a touch for excellence, required for maintaining existing .NET projects. Key Responsibilities: - Maintenance, upgrades, and problem-solving of existing .Net-based projects. Expected Skills: - Proficiency in web, desktop application development and database management. - Experience maintaining .Net projects. - Fast learner, able to grasp the specifics of diverse projects. Note: Knowledge of any specific .Net version wasn't specified; demonstrate your versatility. Regards, Dipak
I need an already fully developed and ready to use online hotel management software. It needs to have booking, reservation, and inventory management features. I need access to this software within less than 24 hours, so it must be ready to deploy. Key Requirements: - Booking Management: The software should allow me to manage booking details efficiently. This includes checking availability, creating new bookings, and updating existing ones. - Reservation Management: I require a system that can handle reservation information smoothly. I need to be able to track reservations, make changes where necessary, and communicate with guests effectively. - Inventory Management: It's vital that the software has a robust inventory management system. This will help me keep trac...
...proficiency in C# and C++, especially in relation to the .NET Framework 4.0. The project's primary aim is to craft a game launcher that offers multi-platform support, but it is crucial to emphasize that our focus for now is on Windows. In case of it's in C++, the following note are required: - The launcher is meant to launch a process (The game exe) also it meant to have a settings window, and support window that contains a "Subject" - "Email" - "How may we help?" and all those data to be sent in HTTP Get request. If it's C#, I only ask for the [Designed Form] as mentioned * Buttons needs to be smooth and high quality animated while mouse hover and mouse click. Key Qualities to have: - Proficiency in C# and C++ - Familiarity with ...
I am searching for skilled web developers to craft an elegant, easy-to-navigate online platform for dress rentals. Features the Online Booking System must incorporate: - Calendar Availability: Customers should see real-time dress availability. - Reservation Management: A streamlined system for tracking and managing dress bookings. - Payment Processing: Reliable, secure processing of customer payments. During the booking process, we need an efficient way to collect key customer details including: - Name - Email - Phone number - Residential Address Managing our dress inventory is crucial and we prefer to handle this manually. Therefore, the system should provide a straightforward means to manually update stock levels. Ideal freelance applicants would have a portfolio showcasing ...
The following questions must be ANSWERED or your proposal will be IGNORED 2. Please send your top 3 best work examples (especially demonstration of any Saas systems or Online Ma...will be IGNORED 2. Please send your top 3 best work examples (especially demonstration of any Saas systems or Online Management Portals, Could base ERP systems) 3. Please send your proposal with your monthly salary expectation JOB DESCRIPTION We are an eCommerce company that requires an experienced Full Stack .Net / React Developer with strong API development experience to join their team due to a significant increase in product demand. Skills & Experience 3+ years C#.NET experience ASP.NET Core HTML5 CSS3, SASS, LESS, Bootstrap, Agile Development Experience Excellent written & ve...
I am looking for a senior software engineer with experience in Java, Python, and C#. The main task is to develop a robust web application using Spring Boot. Familiarity with Azure and .NET will be a plus. Key requirements include: - Developing a web application - Implementing User authentication - Integrating with databases - API integration Ideal candidates should have: - Proven experience in Java, Python, and C# - Strong knowledge of Spring Boot - Familiarity with Azure and .NET - Ability to implement User authentication - Experience in database and API integration. I'm looking for a professional who can deliver high-quality work in a timely manner.
...sites, charge deposits and cancellations, and confirm that all guests have paid the correct amount. Background: Qupqugiaq Inn is a small anti-boutique hotel located in Anchorage, Alaska. We have 37 rooms. Of these, 19 have private bathrooms, 12 have shared bathrooms, and 6 are tiny Japanese-style sleeping pods. Our website is www.qupq.com. Please look at the site before responding. Our main reservation software is WebRezPro. This transmits room information (availability and rates) to the software Siteminder, which then sends the information along to the third party sites, including Expedia, and Hostelworld. Hours: I expect that the work may take 2 or 3 hours per day. Work will be required for the next 4 months. Experience: Please respond with information about your experienc...
I'm looking for an experienced .NET developer to assist with a project. This project requires someone who has a strong background in .NET technology, particularly in C# programming, ASP.NET development, and SQL database management. Ideal candidates should have experience in developing web applications, creating software solutions, and improving existing systems. The key functionalities to be implemented by the .NET developer in this project include user authentication, data encryption, and payment integration. If you're a .NET developer with a solid understanding of the above technologies and functionalities, please reach out to discuss the project further.
I need a professional who can scrape and compile email lists of high net worth individuals with a particular income level and investment interests. The emails will be used to target our automated trading software offer. Key Requirements: - Income Level Criteria: The emails should target individuals with an income level within the range of $250,000 - $500,000. - Investment Interests: The targeted individuals should have an interest in the stock market, Futures trading, options trading, cryptocurrency, and real estate. Ideal Skills and Experience: - Proficiency in data scraping and email list compilation. - Familiarity with targeting high net worth individuals and their investment interests. - Previous experience in compiling email lists for targeted marketing campaigns.
...Experience with .Net, React, React Native, MongoDB, and AWS - Experience in developing white-labeled solutions - Understanding of User authentication and User management - Ability to provide features like Branch Management and Databases - Previous experience with small scale projects (10-50 users) Your role would be to help me create and implement a system that allows businesses to use my product under their brand. This would include setting up user authentication, managing user details, enabling branch management, and ensuring the system can scale up to 50 users without a hitch. Experience in developing similar solutions and strong knowledge in the specified technologies are key. I look forward to hearing from developers who have the skills, experience, and drive to bring this...
...appreciation for your work. Key project requirements include: - **E-commerce Functionality**: The site should be built with the intent of selling legal drafts. This will involve creating a seamless user experience for browsing, selecting, and purchasing these drafts. - **Post-Purchase Delivery**: After a customer purchases a legal draft, I would like them to receive an email link to download the document. This will necessitate a system that can automatically generate and send out these emails upon successful transactions. - **Payment Integration**: The website should support multiple payment methods, including credit/debit cards, net banking, and digital wallets. This will cater to a wider audience and provide convenience for customers. The ideal freelancer for this ...
I'm seeking a .NET Core developer well-versed in fo-dicom or a similar open-source library to create a web-based DICOM viewer. The viewer should be developed using .NET Core web 8.0 with Razor. Key features include: - Image viewing and manipulation: The viewer should allow users to view DICOM images . - Patient information display: It must display relevant patient information in a clear, concise manner. - Measurements and annotations: Users should be able to make measurements and annotations on the images. - Play series: The viewer should support playing a series of DICOM images. The player should be capable to run on Mac, windows and linux i.e. platform independent and should not require any installations on computer. It should run from any external disk like pen driv...
...same industry institutions(All in one) 1. Users to access all institutions' info on the same and one app 2. Institution to pay fees to be visible on the app par category Platinum Diamond Gold Silver Bronze 3. Every week reclassification based on extra payment 4. Clicking on tab , the app will show all institutions' info. Redirection to the institution app 5. Users should also vote using Net Promoters Score(NPS) method 6. The NPS will be sent to all institutions every month 7. The user would win points and MoMo money if he/she recommends the app to other users Condition : recommended users should download/Install/verify/visit at least one institution app/web and recommend new users 8. The institutions will pay an extra amount via the web with a credit/debit c...
I'm looking to add UPI features to my desktop application created with C# .Net. This will involve replicating the encryption and decryption used in major UPI apps, as well as integrating with multiple UPI payment providers and banks. The main features I'm aiming to incorporate are: - Check balance: The application should be able to retrieve and display the user's account balance. - Register: Provide a seamless registration process for new users. - Check pending UPI requests: Show the user any pending requests that require their action. - Approve payment requests: Allow users to approve UPI payment requests. - List of bank added: Display a list of banks that have been added to the user's account. - Data store/retrieve should be in json. -use httpclient ...
vb 2012 video and sound recorder. Auto record to file when motion/sound is detected. Auto save file if no motion/sound is detected for 5 seconds. exe File must be compact and small and not dependent on other dll or ocx. Auto detect existing cam and video device on PC. I should be able to compile it on my PC. Note there are a lot of samples on Chat GTP.
I'm in need of a professional software engineer who can craft a sophisticated travel organizer for us. The project will consist of both a frontend and backend portion. Key Features: - Trip Planning: It's crucial for the software to include a robust trip planning feature that enables users to schedule and organize their travel plans efficiently. - Expense Management: Implementing a reliable and user-friendly expense management system is an essential aspect of the project. The ideal candidate should have a strong background in software engineering, particularly in Angular for the frontend and .net for the backend. Previous experience in developing similar projects, especially in the travel industry, will be a huge advantage. It's also important for the...