Ajax rate control vb net punët
...as in I could literally mock up sites in illustrator and then it would be just a matter of building them as is, if that is an option that would make our workflow more efficient. Things I would l need from the right person: 1. An eye for details. A lot of our communication towards the end of completion on each site would be in regards to small fine elements of the sites as I want the quality control of our output to be high. 2. Ideally I would like to work with someone who has ideas of ways we can make the work even better but my main goal is to find someone at this stage who is simply capable of building something what the clients need. 3. I would want to work with someone who has a knowledge of seo and anything else that would enable to give our clients the best chance o...
me aap ko jam rate me acha kaam kar ke dunga
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I'm on the lookout for an experienced video editor with superior skills in advanced editing techniques including color correction, special effects, and audio enhancement. The projec...techniques including color correction, special effects, and audio enhancement. The project comprises editing a video of a duration exceeding 10 minutes. Skills Required: - Expertise in advanced video editing techniques - Proficiency in color correction - Special effects implementation - Audio enhancement abilities Please note, a storyboard or script isn't provided, allowing you full creative control to bring the footage to life. Applications from individuals with a knack for creativity are particularly welcomed. Your portfolio demonstrating your past work would be advantageous during th...
...incidencias y disputas, proporcionando asistencia inmediata. 3. Ubicación en Tiempo Real: Los clientes podrán compartir la ubicación del vehículo en tiempo real. 4. Seguimiento GPS: Función para monitorizar el viaje en tiempo real, asegurando la transparencia y seguridad. 5. Programación de Viajes: Posibilidad de reservar viajes con antelación según las necesidades del cliente. ADMINISTRADOR 1. Panel de Control: El administrador tendrá acceso a un panel con un listado de choferes por categoría (transporte de pasajeros, liviano, pesado). 2. Monitorización de Estado: El panel mostrará el estado actual de cada conductor, incluyendo su puntuación, créditos disponibles y habilitaciones. 3...
...performance. Strong problem-solving and hacking skills to navigate complex web security systems are essential for this role. Responsibilities: Analyze and improve existing data scraping scripts to maximize efficiency and speed. Implement and manage cloud-based solutions (AWS, GCP, Azure, etc.) for scalable scraping tasks. Develop advanced strategies to bypass anti-scraping measures like CAPTCHAs, rate limiting, and IP blocking. Ensure data scraping processes comply with legal and ethical standards. Troubleshoot and resolve any issues that arise during scraping operations. Collaborate with our development team to integrate scraping solutions seamlessly. Requirements: Proven experience in web scraping and data extraction at scale. Proficiency in programming languages commonly u...
...back to you. If you prefer to direct message, you can do that too. - Ensure that your design aligns with the provided instructions and criteria or it may get rejected. - Plagiarized or copyrighted entries will be automatically disqualified and reported. - Rejected entries indicate missing criteria's and will not be considered. This is not personal just business. . ***Please note this is how we rate your entries right away so you have clear direction of where your entries stand. . RATING SYSTEM: - 1 STAR: indicate that the submission did not meet our expectations and you missed the mark, please consider entering another entry that is different. - 3 STAR: Indicate that we are loving the ideas but its not quite there yet. - 4 STAR: Indicate you are definitely on the right...
...agencies (added advantage) Knowledge of creating and making Standard Operating Procedures (SOPs) for CRM systems Prior experience working with CRM systems Requirements: Proven experience in technical writing, process documentation, or instructional design Familiarity with CRM systems and related concepts (preferred but not required) To apply, please submit your proposal with the following: Your rate or fixed-price quote for the project (Budget: Max Rs. 1000 INR only) A writing sample demonstrating your ability to create clear and concise documentation Your availability to start and estimated timeline for completion We will provide demo login credentials for the GrowCRM system. Although the budget is strict at Max Rs. 1000 INR, we can offer good reviews in return for qualit...
I am seeking an experienced engineer to design and implement a two-axis machine control system that is capable of: - Effectively controlling and managing the movements of the system along two axes with a LIMITED RANGE. Your expertise in designing systems with the necessary navigation strategies and motion control algorithms will be required. - Providing real-time position feedback to the user. Your extensive understanding of feedback mechanisms particular to these types of systems is a must. Ideal expertise for the job includes: - Comprehensive knowledge in machine systems control and design. - A thorough understanding of motion control strategies. - A background in data analysis and logs processing. The machine is a Bandsaw to cut small logs into planks. ...
I currently need an experienced online industrial designer who can help me perfect a textile net for my product designed for basketball practice. The main task will be to take the prototype of my existing product and make improvements so that the textile net pushes the balls towards the center of the court. What I want is not a video or a photo, I want computer checks and force studies to verify and test the reliability and probability of what happens when a ball passes through the inside of the funnel with the subsequent purpose of sending it to be manufactured. It will be necessary to provide measurements, material and verifications.
I need a tech-savvy professional with vast experience in social media account recovery. I lost control of my old Instagram account but I have the username. My main goal is to regain access and permanently delete the account. Key Responsibilities: - Recover lost Instagram account using the provided username - Delete the account upon recovery Essential Skills: - Knowledge and expertise in Instagram account recovery - Experience in similar projects - Understanding of privacy and data security protocols I can provide a driver's license as proof of identity. Confidentiality and transparency during this process are paramount, and I look forward to a successful collaboration.
hello , i currently have my app in playstore up and running. but, i have created this app in drag and drop builder ( Kodular ). which have so much...have created this app in drag and drop builder ( Kodular ). which have so much limitations as well, i am unable to push notifications for the new content. I am looking for someone who can convert or build same app with same interface and structure . What you have to do ? - Convert whole app from kodular to android studio. ( don't want any trace of the app ) - optimize app and UI for higher fill rate of ads. ( i am using FB ads to earn revenue ) - I will share API key once project done. - Allow me to easily update news or content from my PC ( Easy Backend ). - Add one more page to upload my youtube videos into app or into content...
I'm in search of a Social Media Expert who can train me and help me implement a strategic plan to generate leads and sales through social media p...with small businesses or in the B2B sector would be a plus. Your job will be to: - Provide training to help me implement this strategy - Suggest potential modifications or improvements to my existing strategies and techniques. - Present ideas to compliment the company plans. - carryout basic video editing. Initially you will be required around an hour every other day. Let me know your hourly rate & availability. Once we are generating plenty of leads / sales you will be given the opportunity if you like to take over the social media side of the business. Please include examples of previous similar projects in your proposal....
...both iOS and Android systems. Here's the primary features that I'm looking for: - **Real-Time GPS Tracking**: I want my users to be able to track the delivery of their food or the location of their cab in real-time. - **In-App Payment System**: A seamless and secure payment system that ensures a smooth transaction experience for my users. - **Ratings and Reviews**: A feature that allows users to rate and review the quality of both the food delivery service and the cab service. Ideal Skills and Experience for this job: - Proficiency in developing cross-platform applications for iOS and Android. - Experience in integrating GPS tracking systems. - Previous work in developing in-app payment systems. - Understanding of how to implement a user-friendly rating and review fea...
I urgently need an expert in C# to integrate my Point of Sale/Enterprise Resource Planning (POS/ERP) system with QuickBooks Online. The goal is seamless syncing of different modules, including, but not limited to: - Customer Information - Inventory Status - Purchase History - Sales Records - Products, Categories, etc... Familiarity with QuickBooks Online APIs and proficiency in C# .net Core is imperative for this role. Past experience with similar projects will be highly valued. The timeline is urgent; I need this integration done ASAP. we already have a code we made integration with SAP Business One, we can share this code to have the fastest development, and also we have the code of a previous developer who made of Quickbooks so it would help to see how to integrate
...understanding of websockets and their use in real-time applications. Strong problem-solving skills and attention to detail. Excellent communication skills and ability to work collaboratively with stakeholders. Commitment to delivering high-quality code and thorough documentation. Preferred Qualifications: Experience with cross-platform development for both Windows and MacOS. Familiarity with version control systems like Git. Knowledge of backend technologies and integration is a plus. Prior experience with agile development methodologies. How to Apply: Please submit your proposal including: A brief introduction of yourself and your experience relevant to this project. Examples of previous projects or similar desktop applications you have developed. An outline of your approac...
Description: We are seeking a talented web designer to enhance the design and user experience (UX) of our car audio dealers' e-commerce website. Our current platform h...Provide design deliverables using Figma or similar tools. Requirements: - Proven experience in web design and UX for e-commerce sites. - Proficiency with Figma or equivalent design software. - Ability to work within platform limitations to deliver a high-quality design. - Strong portfolio showcasing previous design projects. Additional Information: - You will collaborate closely with me (a .NET and React TS developer) to ensure seamless implementation of the design. - Clear and effective communication is crucial for this project. If you have a passion for web design and a keen eye for detail, we'd lo...
I have a dataset of images and I'm looking for someone experienced in U-Net algorithm. Project description: - Write PyTorch U-Net training model on top of provided base code (, , , ). - Train the model until achieving a validation dice score of min. 0.875. - Deliver source code and trained model until Wednesday 10 pm (Vietnam time zone).
I am looking urgently for a skilled data researcher who will research online UK based local planning authority databases for certain information sets. - Specific focus is needed on planning submissions and permissions that require BNG (biodiversity net gain credits)(the leads). The information is to be taken from Local Planning Authority official websites (publicly available information and no logins required). An in-depth knowledge of planning submissions and permissions and BNG is NOT needed. What is however required is accurate information to be taken from those websites and converted into a database for us. - This work can be done remotely and only requires a computer and access to the internet. - The geographical focus of the UK planning authorities we require information...
Need to update a recently developed site in WP. Need some minor changes. These changes are probably best if they are based on an hourly rate. Please include hourly rate in y9our response. I don't believe this project will take more than 3-4 hours.
...only 2 Product Name columns (in which the "product details of input file column 2" are listed. (example VAT file attached) 3- The app must check that all the lines present in column D "Product details" of the input file 1 are present in column A of the VAT output file and we have a value in column B. If there are lines that are not present or do not have a value, you must report them in the VAT control output file report (attached). 4- Starting from input file 1 (attached), look for the lines of column D "product details" in column A of the newly created VAT output file and insert the respective value present in column B of the file in column K of the example output file (attached). VAT output. 5- Starting from the output file just created, create a ...
**About the Role** We are currently seeking a highly skilled Front-End Developer with a strong focus in React(using Typescript) and a minimum of 12+ months of experience in creating web applications. You will be responsible for the development, design, and implementation of our new website's front-end aspects. This is a **6-month contract** position with a competitive hourly rate. **Key Responsibilities** - Developing new user-facing features using React.js and Typescript - Building reusable components and front-end libraries for future use - Familiarity with RESTful APIs and integrating front-end with back-end services. - Optimizing components for maximum performance across a vast array of web-capable devices and browsers - Implementing an intuitive user interface - Design...
We are seeking a highly sk...-Excellent research skills and the ability to stay up-to-date with industry trends. -Exceptional copywriting skills with a keen eye for detail. -Strong organizational and time management skills. -Ability to work independently and meet deadlines. -Strong communication skills and a customer-focused mindset. Contract Details: -Duration: 6 months (July 2024 - December 2024) -Payment: Monthly payments, rate to be discussed based on experience. -Renewal: Opportunity for contract renewal in 2025 based on performance. If you are passionate about skincare, digital marketing, and creating engaging content, we would love to hear from you! Please submit your resume, a brief cover letter explaining why you are the ideal candidate for this role, and any relevant wor...
I am currently developing the field oriented control system for a permanent magnet synchronous motor. My goal is to improve the speed response, specifically the acceleration time, deceleration time, and steady state error. The project involves the tuning of PI controllers within the system, meant to enhance its overall performance. For this task, a proficient knowledge of control systems, system modeling, and tuning methods is required. Previous experience with PI tuning is beneficial. Currently, MATLAB/Simulink is being used for modeling and system simulation, hence proficiency in it is crucial. Ideally, the candidate will have extensive experience using MATLAB for complex motor control simulations. However, I haven't defined the specific tuning methods to be...
I am looking for an expert with solid experience in Field Oriented Control (FOC) of Permanent Magnet Synchronous Motors (PMSM) who can help tune my PI controllers for more precise speed control. Here are the specifics: - I have an established model using MATLAB/Simulink, and the PI controllers are already implemented. - The key outcome I want is to enhance the accuracy of the speed response. The ideal candidate will have: - Extensive knowledge and experience with PMSM and FOC. - Proven background in tuning PI controllers. - Strong proficiency in MATLAB/Simulink. Your task will involve analyzing the existing model, suggesting enhancements for the PI controllers, and implementing these changes to achieve a more precise speed response.
...despacho de los productos a los clientes, de la misma manera, esta información debe quedar albergada en el sistema con el fin que desde el área administrativa y financiera permita la consulta en tiempo real de los indicadores con el fin de poder tomar decisiones oportunas y ser más competitivos en el mercado. A continuación, los problemas y la necesidad de cada uno de estos: • Problema No hay control en el presupuesto para la ejecución de los planes de mejoramiento • Módulo solicitado Módulo de talento humano • Requerimiento funcional (E) Crear una función dentro del sistema información que permita el área de talento humano poder ejecutar el presupuesto financiero para su área, permitien...
...software developer to create code for a power electronics control system. The project involves using an Arduino DUE and the IMC101T T038 motor controller. The software should control and regulate both the grid side and machine side using Space Vector PWM (SVPWM). Communication between the Arduino and other components will be handled via serial communication. Additionally, the system should include a quadrant display using 4 LEDs to indicate whether it is operating in motor or generator mode. All datasheets and circuit diagrams will be provided. Key Responsibilities: Control and Regulation: Implement SVPWM on both grid and machine sides. Grid-side control: Adjustable power factor (cos(φ)), current, and power. Machine-side control: Adjustable fiel...
I'm looking to develop an Android app using .NET MAUI that focuses on facial detection and tracking for attendance monitoring. Key Requirements: - **Facial Detection:** The app should be able to detect faces in real-time. - highlight detected face with rectangle shape - **Server Communication:** Once faces are detected, the app needs to send this information to a server automatically. - **Attendance Tracking:** The primary goal of the app is to leverage this face recognition technology for attendance tracking purposes.(but no need do any page for this now ) Ideal Skills: - Proficient in .NET and MAUI platform for Android development - Strong experience with facial detection and recognition technologies - Prior work on real-time server communication from mobile apps - ...
...project is to showcase innovation. Key Components: - Canvas app - Component library - Power Automate flows - Environment variables - Connection references Required Application Information: Freelancers interested in this project should provide a brief description of their relevant experience and knowledge. Ideal Skills and Experience: - Microsoft Power Platform and Dataverse Expertise - C# and .NET Development - Package Deployer Tool Proficiency - Power Apps CLI and Visual Studio Code - Experience with Dynamics 365 SDK - Previous experience in publishing PowerApps solutions on AppSource - Ability to work with canvas apps, component libraries, Power Automate flows, environment variables, and connection references - Strong problem-solving skills - Good understanding of the App...
...with a design theme of 'Modern'. The app will be multi-platform, available on both Android and iOS. Key Features: - GPS Tracking: The app should have accurate and reliable GPS tracking to ensure smooth navigation and route optimization for drivers. - Payment Integration: Seamless and secure payment processing is a critical feature for the app. - Rating and Reviews: A feature allowing users to rate and review the service provided by drivers. The ideal freelancer for this project will have: - Proven experience in mobile app development, specifically ride booking apps or similar. - Proficiency in both Android and iOS platforms. - Expertise in GPS integration, payment gateways, and user review systems. - A keen eye for modern design, ensuring the app is user-friendly and...
I'm in need...such as Gmail, Yahoo Mail, Outlook, AOL, and others. - The emails sent are treated as high-priority emails and arrive in the recipient's inbox. I attached some sending errors I received to enable you to know what you're dealing with Key Requirements: - Ability to configure the domain email to send to all popular email platforms. - Ensuring fast delivery to the inbox. - Limiting the email sending rate to less than 20 per day. Ideal Skills and Experience: - Proven experience in email cloud engineering. - Strong understanding of different email platforms' requirements. - Familiarity with setting email delivery rates. - Prior experience with high priority email configurations is a plus. - Excellent communication skills as there may be a need for deta...
Project Title: Basic Audio Note Organizer App (Working Title) Project Description: I need a web application developed to manage and organize short audio recordings. Users should be able to upload audio files (3 seconds max) and categorize them with basic labels. Key Features: User accounts and login system Ability to up...audio files Secure storage of user data (audio files and labels) Target Audience: This app caters to users who want a simple way to organize and access short audio snippets for personal use. Think of it as a basic audio version of a text-based note-taking app. Please Note: This is a very basic project focused solely on functionality. No need for fancy features like audio editing, playback speed control, or file sharing. Design aesthetics are unimportant at t...
Hi, Looking for a person to create an spread sheet monthly for sales records during that month. Will need to take information off of individual sales order sheets/emails and transfer it onto a spread sheet... buyer/address/item(s) they bought/amount they paid etc. Will be a reoccurring task per month. Will pay per month, expecting 100-200 sales per month. Please show rate per entry.
We are in need of a highly skilled Laravel expert team to continue development on existing web application! The specific Task - Requirements Document will be provided. Select...Document will be provided. Selected team will be having opportunity to work for long term! Skills and Experience: - Extensive experience in Laravel development - Proficiency in Laravel customization and optimization - Strong understanding of Gitlab - version control !* - Excellent problem-solving skills and attention to detail - Database Design & Management: The ability to design and manage a highly organized, efficient database is crucial. Skills that would be beneficial: - Thorough Laravel expertise - Understanding of Git version control - Proven track record in creating database structures a...
We are in need of a highly skilled Laravel expert team to continue development on existing web application! The specific Task - Requirements Document will be provided. Select...Document will be provided. Selected team will be having opportunity to work for long term! Skills and Experience: - Extensive experience in Laravel development - Proficiency in Laravel customization and optimization - Strong understanding of Gitlab - version control !* - Excellent problem-solving skills and attention to detail - Database Design & Management: The ability to design and manage a highly organized, efficient database is crucial. Skills that would be beneficial: - Thorough Laravel expertise - Understanding of Git version control - Proven track record in creating database structures a...
...development. Requirements: - Strong proficiency in HTML, CSS, and JavaScript. - Experience with modern front-end frameworks such as React, Angular, or Vue.js. - Familiarity with TypeScript and its benefits in front-end development. - Knowledge of responsive web design principles and cross-browser compatibility. - Understanding of web accessibility standards and best practices. - Experience with version control systems, preferably Git. - Familiarity with RESTful APIs and integrating front-end with back-end services. - Ability to write clean, modular, and reusable code. - Strong problem-solving skills and attention to detail. - Excellent communication and collaboration abilities. - Passion for creating inclusive and user-friendly web experiences. If you are excited about using yo...
...Swift. Strong knowledge of iOS frameworks, SDK, and the iOS ecosystem. Familiarity with design principles and user interface guidelines for iOS. Experience with RESTful APIs and third-party libraries. Excellent problem-solving skills and attention to detail. Strong communication and teamwork abilities. Ability to work independently and manage time effectively. Prior experience with version control systems (e.g., Git) is a plus. Availability to work part-time hours as agreed upon. Preferred Qualifications: Previous experience developing and releasing apps on the App Store. Familiarity with agile development methodologies. Knowledge of other mobile platforms (Android, Flutter, React Native, etc.) is a plus. Experience with automated testing and continuous integration. ...
...). I tried to assess if there is an issue with the code at , but they didn't response. The name servers are , , and (ns-2 not yet added in the .net zone). Server locations are AWS Oregon, Germany, and Germany, respectively, all on different AS. DNS services run on TCP and UDP ports of IPv4 and IPv6. The name servers are their own authoritative servers, so there are glue records in the .net zone, see attachment. I can send you the bind configuration files. Unfortunately, I cannot give you SSH access to the servers. If you need to add records to the servers for debugging purposes, I'm happy to do that. Can you help me?...
I am in need of a compact PCB design for a relay bank. The primary application of this relay bank is for industrial control, so the design needs to be both efficient and reliable. Key requirements: - The relay bank should be small in size, while still accommodating 6 triggers at 230 volts. - The design must include a dry switch rated at 13 Amps. - The PCB must be designed with the intention of obtaining CE certification. Ideal skills for this project include: - Proficiency in PCB design, particularly for high voltage applications. - Experience in designing for industrial control applications. - Knowledge of CE certification requirements for PCBs. It's crucial that the design be not only functional but also compliant with CE standards. I look forward to working with ...
I'm looking for a professional social media manager who can take charge of my accounts. I would like an engaging and interactive social media presence to help build my brand and drive traffic to my website. The ideal candidate will have: - Experience in managing social media accounts - A track reco...social media accounts - A track record of successfully growing social media followings - Excellent communication skills - Creativity and the ability to create engaging content - Experience in managing social media advertising (though not essential, this would be a bonus) Please include in your proposal: - Your relevant experience - Any examples of previous work - Your availability and proposed rate for ongoing management - Any additional services you could offer (e.g., paid soci...
...to search for trainers or classes based on the city or trainer's name. This will make it easy for students to find trainers that are close to them or whom they may have heard of. - **User Profiles**: Each trainer or class should have a detailed profile which includes: - Biography: A brief description of the trainer and their training methods. - Reviews and Ratings: Users should be able to rate and write reviews about the trainers/classes. - Contact Information: Trainers should be able to list their contact information so that interested students can get in touch with them. The ideal candidate for this project should have experience in developing complex web portals with multiple user types, advanced search functionality, and user-generated content. A keen eye for ...
...ADS1115 interface a display grafically Display have to rappresent data in 4 different page changeable touching icons placed in down part of display In each page are displayed more rounded bar with % value received from 3 x ads1115 i2c connected Key Responsibilities: - Program the ESP32 to recognize and interpret the data from the I2C ADS1115 sensor module - Integrate a responsive touchscreen control and an LCD display on the Waveshare ESP32 s3 Touch LCD 4.3 - Ensure the system is user-friendly and able to display the sensor readings accurately - Implement the system in a way that is easy for someone with an intermediate level of programming experience to understand and modify Ideal Candidate: - Proficient in Arduino and ESP32 programming - Prior experience working with touchs...
Required a dot net developer. Speacialized in Microservices acrhitecture based solution. Dotnet Core, C#, SQL, Data transformation, API gateway, Auth based security.
I'm in critical need of an SEO expert who can help me elevate my website on all fronts. The main goal is to not just increase traffic but to also improve my search engine rankings and ultimately, boost the conversion rate. Key Requirements: - **Boosting Website Traffic**: My current website traffic is insufficient and I need a substantial increase. The ideal candidate should have a proven track record of significantly increasing website visitors in a time-efficient manner. - **Enhancing Search Engine Rankings**: I want to rank higher on search engines. The freelancer should be proficient in SEO strategies and techniques, and be able to provide a plan for optimizing my website's ranking. - **Generating Leads and Conversions**: Ultimately, the goal is not just to increase t...
I am looking for an experienced .NET developer who has worked on both web and desktop applications. The ideal candidate should also have a strong background in algo trading and low latency applications. Key Requirements: - Experience with C# and Visual Studio for .NET development. - Previous work on both web and desktop applications. - Proven experience with algo trading. - Prior experience working in low latency applications - React JS work experience is added advantage Skills: - Worked with Websocket, REST APIs - React JS - Ability to understand code written by others and refactor. - Write clean, robust and performant code. Your role will involve: - Building and maintaining robust, high performance applications. - Using your knowledge of algo trading to implement and opt...
Thanks for considering us for the project. We agreed on 1350 USD per month rate and you are going to bear 50% freelancer fee as well. We are going to provide full time flutter resource for the requirements as well. He is going to work 8 hours in a day for full month.
I'm in need of a skilled buying agent based in Thailand, focused on sourcing suppliers for tobacco. The aim is to find reliable, quality suppliers predominantly in the tobacco industry. Skills & Experience Required: - Extensive experience as a buying agent - Good knowledge of the Thailand market, particularly tobacco - Strong network of su...agent - Good knowledge of the Thailand market, particularly tobacco - Strong network of suppliers - Proven record of sourcing quality home appliance, electronic, and fashion suppliers - Excellent negotiation skills This is an ideal opportunity for anyone who: - Is familiar with Thailand and the tobacco industry - Has experience sourcing and negotiating with suppliers - Has a keen eye for quality control. Please do not apply if not...
