Combobox control vb net punët
...as in I could literally mock up sites in illustrator and then it would be just a matter of building them as is, if that is an option that would make our workflow more efficient. Things I would l need from the right person: 1. An eye for details. A lot of our communication towards the end of completion on each site would be in regards to small fine elements of the sites as I want the quality control of our output to be high. 2. Ideally I would like to work with someone who has ideas of ways we can make the work even better but my main goal is to find someone at this stage who is simply capable of building something what the clients need. 3. I would want to work with someone who has a knowledge of seo and anything else that would enable to give our clients the best chance o...
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I'm in search of a skilled .Net mobile developer to finalize my .Net Maui mobile application. The key tasks include: - Implementing the logic, specifically around user interface interactions. - Although user authentication, data synchronization, and push notifications were not explicitly mentioned, familiarity with these aspects would be advantageous for potential troubleshooting or further development. The mobile application is already well underway, with views, and a nearly finalized backend. Therefore, I need a freelancer who is proficient in both .Net and Maui and can confidently complete the application. Ideal skills and experience: - Proficiency in .Net and Maui - Experience in mobile application development - Understanding of user interface intera...
...performance improvements. - Regular software updates and security patches. - Feature additions and enhancements. Skills and Experience: - Proven experience in maintaining e-commerce solutions. - Proficiency in React, Node.js, Python, and MySQL. - Strong problem-solving skills. - Excellent understanding of software best practices and design patterns. - Ability to work independently and meet deadlines. - .NET and are a plus but not a requirement. Prerequisites: For the long term project the *STARTING* wage will be as stated below. 1) Accept initial hourly rate of U$5.00 2) If awarded, accept and start work IMMEDIATELY 3) Have MINIMUM OF 20+ hours a week for long term ongoing support and development. 4) Work hours: predominantly 20:00 to 02:00 (UTC -3 Brazil TIME) 5) Be availabl...
I'm in need of a skilled cross-platform app developer to create an application for my car cover company. This smart home app will control WIFI lights and fans specifically. Key functionalities include: - Ability to control lights - Control fans - Monitor humidity This application is all about automation, so it requires a development team with a strong background in cross-platform app development, specifically working on smart home apps. Awareness of IoT would be beneficial, given the smart home focus. Considering user experience, the app should be intuitive, easy to use, and visually appealing, therefore, UX/UI design skills are critical. This project is an interesting opportunity to work on an application that moves beyond standard functionalities and delve...
We need the following features: 1. Login/ registration 2. Stripe integration 3. Place and order 4. After placing order, user can upload files to start project 5. Admin receives files from order. 6. Email notification about order progress to user and admin 7. Admin uploads final report pdf to order and marks complete 8. User can download ...and admin 7. Admin uploads final report pdf to order and marks complete 8. User can download report from order page. End of flow. More details: What specific features would you like to include in the SaaS dashboard? User management, Payment processing, Upload and download files How do you envision the user interface of the SaaS dashboard? Modern and intuitive design What level of user access control do you need? Basic (e.g., admin and user r...
VM CREATION (1 VPS BIND) os CentOS 8 & 9 Stream MINIMAL Direct installation or converted from CentOS 8 Linux. (Recommended) panel add install: nginx server VARNICH APACH very important !!!!!snaphopt image creation just servers working (just os) (without admin panel)!!!I want to be able to do restores, for a new installation of another panel, if necessary.! !!! !! !!!!!! link to server add SSL ADD ALL PHP CGI AND FMP (latest 6 versions)PHP AVAILABLE FOR CUSTOMER FOR ALL SERVER ADD PHP VERSION 7.9 PACHT FMMPEG add latest version change SSH22 port verification example: ns1 . add IP.: add a Mac machine adds IP.: adds mac Example of adding HOSTENAME: my
I am in search of a skilled .NET Core developer to work on a project for me. As the client, I'm looking for someone who can bring the following to the table: - Proficiency in .NET Core: Given that my project is based on this technology, familiarity and experience with it is a must. - Application Development Experience: Previous experience in developing web applications would be particularly beneficial. - Strong Problem-Solving Skills: The ability to troubleshoot issues and devise solutions is key. - Attention to Detail: It's important that our project is implemented correctly and accurately. The ideal candidate for this project would be someone who understands the nuances of .NET Core, has a good track record in application development, and can work efficie...
I currently need an experienced industrial designer who can help me perfect a textile net for my product designed for basketball practice. Online, the main task will be to take the prototype of my existing product and make improvements through computing and then send it to be manufactured.
...a filing system that is organized and intuitive, ensuring that users can easily locate and retrieve the documents they need. I require a freelancer who has experience in developing document management software, particularly for Windows. The software should be designed to handle a large volume of documents while maintaining high performance. A strong understanding of cybersecurity and access control is also important to ensure the confidentiality of the documents. Once a document is scanned a title and name is given and physical copy filed into numbered box file. If document is required a quick search by name, title etc will reveal where the hard copy can be found as well as the digital copy can also be brought up. I will send the successful candidate a detailed description ...
...assist me with chip debugging, specifically through JTAG, to troubleshoot hardware issues. Key Points: - The main objective is troubleshooting hardware issues, specifically related to microcontrollers. - You will need to have a high level of expertise in JTAG debugging, with an emphasis on processor control. - The project will require access to the processor for controlling its operations. Ideal Skills and Experience: - Proficiency in JTAG debugging, particularly with a focus on processor control, is essential. - Prior experience in troubleshooting hardware issues on microcontrollers is highly preferred. - A deep understanding of chip architecture and debugging techniques is necessary for this task. If you have a strong background in chip debugging through JTAG, particu...
...developing. The design will be specifically for a mobile platform. Key Features: - Real-time Monitoring: The primary function of the app is to provide users with real-time monitoring of their smart home devices. - Notifications: The app should be able to push notifications to users to alert them of any important events or changes in their home. - Remote Control: While not explicitly mentioned, I'd like to ensure that remote control features are intuitive and accessible in the design. Your deliverables should include wireframes, mockups, and a clickable prototype. Prior experience in designing for IoT or home automation applications is a big plus. Please also provide a portfolio of your previous UI/UX designs for mobile apps. Looking forward to seeing your crea...
...Required skills and qualifications: 1. Good communication skills and the ability to articulate technical concepts to non-technical stakeholders. (English Level: B2 ++) 2. Proficiency in HTML, CSS, and JavaScript. 3. Experience with front-end frameworks such as React, Angular, or Vue.js. 4. Strong understanding of responsive design principles and mobile-first development. 5. Familiarity with version control systems, such as Git. 6. Excellent problem-solving skills and attention to detail. 7. Ability to work independently and collaborate effectively within a team. If you are passionate about creating exceptional user experiences and have the skills to bring our vision to life, we want to hear from you. Please include examples of your previous work and describe your approach to fr...
I'm in need of a Python application that can connect around 200 Android and iPhone devices to a PC via USB cables, allowing me to perform various automated tasks and workflows on them. Key Requirements: - **Bulk Control**: The app should be able to interact with all connected phones simultaneously. I should be able to create and assign tasks to each phone individually, or define tasks that apply to all devices. - **Task Automation**: I need the app to automate several types of tasks, which include: - Web browsing or searches: The app should be able to instruct the phones to browse certain websites or perform specific searches. - App testing or usage: The app should be capable of launching and interacting with various applications on the phones. - Content downloading or u...
...fingerprint, and iris recognition. The paper should explore the theoretical aspects of these biometric methods in the context of access control systems. The ideal candidate for this project should have: - Proficiency in biometrics, particularly face, fingerprint, and iris recognition - Strong research and analytical skills to perform a detailed theoretical analysis - Understanding of access control systems and their relation to biometrics - Excellent academic writing abilities to present the findings clearly and coherently The research paper should not only explain the underlying principles of these biometric methods but also delve into how they are utilized in access control systems and their implications for security. No case studies are required; the focus is p...
Full Stack .NET Core Developer Needed to develop our whats app api platform A basic requirement is that he has previously worked on the WhatsApp API platform. I can review it before starting work
I am seeking an experienced freelancer to code for an Industrial Automation System specifically focusing on manufacturing process control. Key Tasks: - Develop efficient code for my Industrial Automation System. - The code should aim at automating the manufacturing process control. - Testing the code for effectiveness and making necessary improvements. Skills and Experience: - Strong experience with IoT devices, especially industrial automation systems. - Exceptional coding skills, particularly in an industrial background. - Experience in manufacturing process control. - Ability to work quickly and effectively, as the project is needed ASAP. Experienced with Microsoft Azure Timeframe: The project should be completed as soon as possible. Applicants should have im...
We are in need of a highly skilled Laravel expert team to continue development on existing web application! The specific Task - Requirements Document will be provided. Select...Document will be provided. Selected team will be having opportunity to work for long term! Skills and Experience: - Extensive experience in Laravel development - Proficiency in Laravel customization and optimization - Strong understanding of Gitlab - version control !* - Excellent problem-solving skills and attention to detail - Database Design & Management: The ability to design and manage a highly organized, efficient database is crucial. Skills that would be beneficial: - Thorough Laravel expertise - Understanding of Git version control - Proven track record in creating database structures a...
...able to work with IaC definitions (e.g., Terraform, Ansible, Kubernetes Manifests) • knowing some database administration foundational principles Knowledge in Container Orchestration You have experience in setting up Kubernetes clusters and dealing with persistent storage (in this case: a ceph cluster). DevOps Culture You are experienced in git version control and have an open mindset towards open-source solutions. • knowing git version control and how to live the DevOps culture • having an embracing mindset towards Open Source • being supportive and consulting when it comes to interacting with the stakeholders from our projects that will be on the platform • advocating for projects to align to the way the platform works and convincingly explain...
I need a professional content creator skilled in human development to provide me with 30 video scripts and ideas for my business centered on getting rid of old block how nervous system control you, personal growth, overcoming fears, and building self-confidence. Each script should be educational and informative, while maintaining a concise length of 1-3 minutes. Key Requirements: - A solid understanding of human development, personal growth, and related topics - Proven experience in creating concise and engaging video scripts - Ability to convey complex information in an easy-to-understand manner - Strong writing skills with a focus on educational content - Previous experience with similar projects is highly preferred Your work will play a crucial role in helping individuals over...
...1) Linux staging server setup -> deploy our existing project to a new VPS using gitlab 2) Woocommerce -> continue long term development work on our existing custom plugin. Transfer the existing production woocommerce to this staging server. 3) ongoing long term development of our CRM app Other components of our stack which are a HUGE ADDED BENEFIT if you can work on them -> .NET ASP, WEB API + MS SQL DETAILS HERE -> PRIORITY IS TO HAVE A DEVELOPER ON OUR TEAM (LONG TERM) THAT CAN FOR NOW ALSO WORK WEEKENDS AS WE HAVE SEVERAL EMERGENCIES TO FINISH URGENTLY. Someone who can efficiently manage Linux VPS and efficiently use GITLAB is critical. Initially we need part of the hours to be worked in the first weeks from 8:00PM- 2:00am UTC -3 (Brazil Time)
I'm seeking an experienced 3D designer to create a model for a walking training dog harness. This needs to accommodate medium (30-60 lbs)...attachment. The front leash attachment will be like a choke chain collar attachment (see attached). Fluent expertise in 3D modelling software is paramount. Previous design experience in pet accessories would be advantageous. I will also require manufacturing designs. Expectations include: - Designing a multi-feature training harness - Ensuring durability for mid-large dogs - Prioritizing comfort and control in design - Incorporating both a front and back leash attachment - Showing the dinosaur skull head in white with black background. - breathable fully adjustable polyester webbing chest with integrated choke collar design with back leas...
I am looking for a tech-savvy professional who can create an application that allows for seamless remote control of ventilation systems. The ability to work across multiple platforms is essential as the application needs to be compatible with iOS and Android devices, as well as Windows computers. Primary Features: - Timer scheduling - Remote control of ventilation systems - Monitoring parameters including temperature, humidity, twilight, and weather - Real-time notifications and alerts - Scheduling system actions - Support for multiple users simultaneously Given the sensitive nature of the data and operations, the application must be secure. Your work will involve implementing advanced encryption to safeguard our communications and data. The ideal candidate for this projec...
...AS WE HAVE SEVERAL EMERGENCIES TO FINISH URGENTLY. We will start with 5-10 small task in and then go to some smaller .NET tasks all with 1 day sprints for you to become familiar with the software and then our main goal will be to integrate another B2B API for our MVNO. Initially we need part of the hours to be worked in the first weeks from 8:00PM- 2:00am UTC -3 (Brazil Time) later you can work on your time zone. If you are awarded the task we expect you to accept IMMEDIATELY and if the project is not accepted immediatly we will award it to another developer. To qualify you must be full stack and work PROFICIENTLY with gitlab and code in ., .NET ASP, WEB API + MS SQL. We also have woocommerce and have developed and will continue to develop plugins, so PHP and unders...
...designer/animator to create 21 high-quality assets for our website, Dealer Essential. These images will be used to enhance our Products page and other sections of our site, highlighting the benefits and features of our software for small-medium dealerships. Project Details: - Budget: 80 NZD $ - Delivery Timeline: 2 days - Number of assets: 21 - Page Link: Design Spec Example: ---Experience in creating professional, high-quality website images/animations ---Ability to understand and visually communicate the key benefits and features of our software ---Fast turnaround time without compromising on quality ---Familiarity with the automotive dealership industry is a
I'm in need of a professional voice over artist for an advertising project. - Purpose: The main aim is to create a captivating advertisement for adults to be aired on the radio. - Tone: I'm looking for an upbeat and energetic tone that will help drive interest i...voice over artist for an advertising project. - Purpose: The main aim is to create a captivating advertisement for adults to be aired on the radio. - Tone: I'm looking for an upbeat and energetic tone that will help drive interest in the product. - Target Audience: The primary target is adults. Ideal candidates should have: - Experience in creating engaging advertising voice overs. - Excellent control over tone and pace to convey the desired energy. - Understanding of the audience and ability to adapt the...
...equipment. Please search for this technology. 【3 Reference information】 This technology pertains to devices that perform authentication processes with other equipment using wireless communication. Specifically, these devices use Ultra-Wideband (UWB) wireless communication and include a control unit that conducts vehicle control based on measured distances. Furthermore, this technology is intended for application in vehicles. The device is expected to enable efficient and accurate authentication and vehicle control. <<NOTICE>> The target car brands in this search are limited to US, European, Chinese, and South Korean brands. <Requirements for Payment> ・Submit documentary evidence that clearly states the details of the subject product, the name of ...
...an initial timeline, which will be adjusted weekly All code created will be the exclusive property of Next. Next project: 1. Create a timeline. 2. Create a wireframe of the project 3. Create the UX of the project while the rest of the project progresses. 4. Create the AWS site, create/set-up the servers and databases while the rest of the project progresses. 5. Create the Affiliates Setup and Control site 6. Create the Affiliate site - xx days 7. Create the Training site – xx days 8. Create the End User site – xx days 9. Create the Customer Management site – xx days 10. Create the Service Ticket site – xx days 11. Create the Routing and Scheduling site – xx days 12. Create the Billing Center site – xx day 13. Create the CPNet site –...
...information] ([1] and [3] are for reference only) 【1 Background】 This technology pertains to a vehicle control system designed to enable specific operations on a vehicle. Traditionally, there has been a smart system utilizing electronically authenticated keys through wireless communication with the vehicle. However, a new method using sound authentication with a device worn on the user's ear has been proposed. While this device offers a novel way to authenticate with the vehicle, using standard communication protocols allows authentication from a distance, which could lead to risks of unauthorized access by third parties. Therefore, the goal of this technology is to provide an improved vehicle control system that reduces the risk of such unauthorized manipulations.【2...
...my previous system. Key Requirements: - The previous application had User Authorization and Role-based Access Control. This needs to be replicated in the new application. - The following user roles were present in the old system and need to be retained: - Admin - Manager - Regular User - View - Each role had specific actions or permissions: - Admin: Full access (Create, Read, Update, Delete) - Manager: Full access (Create, Read, Update, Delete) - Regular User: Full access (Create, Read, Update, Delete) - View: View Only access Ideal Skills: - Strong experience with Spring Security. - Proficiency in Struts framework. - Understanding of Role-based Access Control. - Ability to efficiently configure permissions based on user roles. Looking for a freelancer ...
...vehicles on a head-up display when there is a possibility of these vehicles merging from adjacent lanes. Although this technology is introduced, it is noted that there is room for improvement. Specifically, the challenge is to make it easier for drivers to identify merging maneuvers executed by vehicles in adjacent lanes. 【2 Technology Description】 This technology relates to a vehicle display control device that includes a processor. The device is designed to handle scenarios where other vehicles traveling in lanes adjacent to the vehicle's own lane perform merging actions. The processor controls a display unit that shows images representing the vehicle’s lane, the adjacent lane, lane boundaries, and other vehicles. The controlled display unit has the capability to mo...
...device. This vehicle is equipped with an input unit where a charging connector provided on the charging device is connected, a control unit that communicates with the charging device, a power storage device that is supplied with power through the charging connector, and an input unit where the user makes inputs. If the control unit determines that a charge stop request has been input to the input unit during charging, the control unit is designed to stop charging. 【3. Reference Information】 The vehicle is equipped with an input unit that includes at least one of an accelerator pedal, brake pedal, ignition switch, hazard switch, and door lock button. If the control unit determines that a pre-set charge stop operation has been performed at the input unit, it ...
...have two servos linked with each other and have to move relative to one another. We have a 3d model of the assembly and should be simulated before delploying Key Requirements: - Expertise in Siemens PLC programming, specifically with the S7-1500 model. - Proficiency in programming servo tasks such as motion control, positioning, and synchronization. - Ability to work with existing hardware and servo motors setup. You should be able to understand and execute tasks related to motion control, positioning, and synchronization. Your experience with servo programming will be important, as the project is very much about working with these systems. It's also essential that you're comfortable working with the S7-1500 model. Please bear in mind that the hardware and se...
I am in need of an experienced individual to assist in the development of a W...Previous experience in WSN network simulation - Able to develop a proprietary MAC protocol - Proficiency in relevant programming languages and software such as NS2/NS3, MATLAB, or OMNeT++ - Strong understanding of WSN system design Your primary role will be to help me create a comprehensive simulation that accurately represents a WSN network, as well as develop and test a proprietary Medium Access Control (MAC) protocol. This will require a keen eye for detail, a solid understanding of network architecture, and a strong background in programming and simulation software. If you have a proven track record in this area and are dedicated to producing high-quality research simulations, I would like to hear...
I am looking for an accomplished specialist in report writing who can deliver a detailed and effective quality control inspection report for factories located in China. This report is specifically intended for external auditors usage and thus, it must be both accessible and impressive in its detail and clarity. While detail being key, simplicity should be above all else. Key Requirements Include: - Performance Evaluation: Analyze and document the performance of various processes of the factories product. - Compliance with Standards: Evaluate and report on the compliance of processes with established standards if applicable. - Detection of Defects: Detect and describe any defects encountered during the inspection. - Process Failure Theory: Include a section on the potential reasons ...
I'm looking for a skilled freelancer to develop a customized net worth spreadsheet. This spreadsheet should enable me to meticulously track my financial progress across various categories. Key Requirements: - The spreadsheet should allow me to input and monitor: - Investments (especially individual stocks) - Debt - Savings - Income - Expenses - Other category for miscellaneous expenses or income - I require a simple, user-friendly design that makes manual data entry easy and intuitive. Skills and Experience: - Proficiency in spreadsheet software such as Excel or Google Sheets is essential. - Experience in financial tracking and net worth management is highly beneficial. - Understanding of stock market, investment tracking, and basic accounting principle...
As a business looking to expand into the Chinese market, I am in need of a reliable and skilled individual to act as my agent there. Your responsibilities will include: - Sourcing manufacturers: You should have experience in identifying and working with manufacturers of stuffed animals. - Quality Control: Ensuring that the products meet the required standards prior to shipping. - Logistics: Managing the transportation and distribution of the soft toys effectively and efficiently. I am particularly interested in tapping into the market for children's toys in China and so the ideal candidate should have a good understanding of the Chinese consumers and market trends in this segment. Your role will be pivotal in establishing our brand and products in China, so I'm lookin...
I'm looking for an experienced agronomist to optimize my large pasture hay operation, which is over 50 acres. Responsibilities will include: • Performing soil analysis • Managing crops effectively • Implementing pest control A deep understanding of pasture hay is critical. Experience in dealing with large-scale operations would be beneficial. Your insights will have a direct impact on the productivity and success of my farm. Will require detailed schedule of activities and equipment required to optimise land production. Near Maldon Victoria.
...need of a skilled PLC programmer with experience in Siemens systems for an assembly line automation project. The system is an integral part of our broader industrial automation initiative. Key Project Components: - The project involves optimizing and automating our assembly line processes. This includes streamlining the control and monitoring of processing machines and ensuring the efficient control of machinery. Key Responsibilities: - Design and develop the PLC control system in alignment with our assembly line automation needs. - Program the system for optimal performance, ensuring reliability and efficiency. - Integrate the PLC system with the rest of our industrial automation setup, to create a seamless, cohesive system. Ideal Candidate: - Proficiency in pr...
I need professional assistance in migrating my domain registration and website content from Inmotion (web server host) to Shopify. In particular, I am looking for a smooth, hassle-free relocation that ensures absolute minimum downtime and zero data loss. Key Tasks: - Transfer the control of my domain () back to registrar 123-reg, so its controlled there. - Then connect the domain () to my current shopify store where we have a webshop built - Transfer the email records from inmotion to shopify/123-reg so the () emails are still functioning - Make sure that the website is fully functional post-transfer - Make sure () email is also fully functioning via Google Workspace Ideal Candidate: - Proven experience
Se trata del desarrollo de un sistema electrónico de control, basado en Raspberry para la lectura de sensores (Spo2, PH, temperatura, espuma, etc) y el control de sistemas de (calentamiento, bombeo ingredientes, agitación, bombeo aire) , utilizará una tablet y un panel de Thingsboard como interfaz de control y monitorización. El trabajo consiste en el diseño de una PCB de integración modular de los elementos y la programación del sistema de control así como las pruebas y puesta en marcha.
...scalability. CI/CD: Implement CI/CD pipelines using GitHub Actions to automate testing and deployment. Cloudflare: Use Cloudflare for security (DDoS protection, WAF, SSL/TLS encryption), performance optimization (CDN, image optimization), and DNS management. 3. Specific Integrations or Third-Party Services OKTA: For secure tenant-based authentication and user management. GitHub: For version control and collaboration. DataStax Astra: Managed Cassandra database service for data storage. Netlify or Vercel: For hosting and deploying the frontend application. Monitoring and Logging: Prometheus and Grafana for monitoring. The ELK Stack for logging and analysis. Cloudflare: For DDoS protection, CDN, SSL/TLS encryption, load balancing, and traffic analytics. 4. Expected User Base...
I am seeking a professional to design an Internal Control Quality Assurance Framework to ensure compliance with regulatory requirements. The project will specifically focus on enhancing customer service operations, which currently faces various process-related challenges. Key Responsibilities: - Designing an Internal Control Quality Assurance Framework focused on regulatory compliance. - Analyzing and improving customer service processes. - Identifying and addressing specific process-related challenges. Ideal Skills and Experience: - Prior experience in the insurance industry, particularly in risk management. - Expertise in designing Internal Control Quality Assurance Frameworks. - Proven track record in process analysis and optimization. - Strong understanding of r...
...International Medial License expires in 3 years from date of issue so a mechanism to update credentials and apply for renewal of IBMS International medical license should start approximately 4 months prior to expiration and this will have to be updated on the healthcare providers profile. • THE ULTIMATE SOLUTION IS AN AUTOMATED SYSTEM TO DEVELOP AND PREPARE THE IBMS IML FOR MAILING, RENEWAL • QUALITY CONTROL - The final completion will be reviewed by IBMS representative in charge of IBMS IML...
...Remote Transducer (HART) protocol within a new RF control system. This protocol implementation will primarily serve to monitor Radio Frequency (RF) components used in aerospace. To be successful in this endeavor, you should possess the following: - understanding and practical experience with HART protocol HW and SW design and development - Familiarity with aerospace RF components and systems (minimal - I'll be doing the RF/microwave system design) - Ability to build a uP control system from the ground up - Extensive experience in device monitoring, end to end HART transmission and reception Understanding of both transmitters, sensors, and valve positioners in context with HART devices would be beneficial. Your role will be to develop a new control system, e...
I'm looking for an experienced Android developer, specialized in Kotlin, to create a business application. This app will be specifically designed for employee management and control. The project has already started, more than 30% of the layouts have been developed in code and the programming part. All layouts are already predefined with figma. All the content that is available to date of the application and support regarding resolution of doubts and functionalities will be provided to the programmer. Key Features: - Time Tracking: The application should allow employees to record their work hours. This feature will be crucial for tracking attendance and payroll calculations. - Employee Location Tracking: I want the application to have a feature that enables employers to monito...
Crea un sistema en Java, usando el IDE NetBeans y Xampp para la simulación de un sistema de control de empleados. En este proyecto desarrollarás las funcionalidades básicas del uso de Java e interacción con gestor de base de datos (MySQL) el uso de la biblioteca Swing de Java. Puntos para evaluar Uso de Variables Uso de Operadores Uso de Sentencias Uso de Instrucciones Uso de Arreglos Uso de Programación orientada a objetos Uso de Variables de texto Uso del controlador JDBC