Asp net hotmail contacts import vb punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I'm looking to obtain contact information, specifically email addresses and physical addresses, of local jewellery shops from multiple countries. This information will be primarily used for a marketing campaign. The ideal freelancer for this job should possess: - Proficiency in web research and data collection - Proven experience in lead generation - Knowledge about the jewellery shop industry. I'm particularly interested in local artisans, as opposed to high-end luxury shops or exclusively online retailers. Please apply if you are confident in gathering accurate and quality data from various resources.
I have a project that entails exporting contacts from one database and merging them in a particular manner. Here's what I need: • Transferring data between databases -- changing to a new program • Combining the Excel rows into a single cell. Only the address, city, state, zip into one cell. Name, phone, email will stay separate. • The final format for the merged data should be in CSV. Ideal skills and experience required for this project include extensive knowledge about Excel functionalities, CSV formats, and database management. Previous experience with contact data transfer and merging will be highly appreciated. Let me know if you've done similar jobs in the past.
...current process excel files will be given aswell as the detailed process) Request Submission: Teams within the company fill out an Excel file with transport details, including pickup location, destination, size, and weight of the shipment. Courier Selection: The logistician identifies 3 or 4 potential couriers from a database based on the transport's distance, size, and location. The logistician contacts these couriers via Outlook to inquire about availability and pricing. Selection and Confirmation: Upon receiving responses, the logistician selects the best courier based on price and availability. The logistician fills out an order form in Excel, converts it to PDF, and sends it to the chosen courier to confirm the shipment. Project Goals: Automate Courier Selection: D...
I'm in search of a skilled .Net mobile developer to finalize my .Net Maui mobile application. The key tasks include: - Implementing the logic, specifically around user interface interactions. - Although user authentication, data synchronization, and push notifications were not explicitly mentioned, familiarity with these aspects would be advantageous for potential troubleshooting or further development. The mobile application is already well underway, with views, and a nearly finalized backend. Therefore, I need a freelancer who is proficient in both .Net and Maui and can confidently complete the application. Ideal skills and experience: - Proficiency in .Net and Maui - Experience in mobile application development - Understanding of user interface intera...
...performance improvements. - Regular software updates and security patches. - Feature additions and enhancements. Skills and Experience: - Proven experience in maintaining e-commerce solutions. - Proficiency in React, Node.js, Python, and MySQL. - Strong problem-solving skills. - Excellent understanding of software best practices and design patterns. - Ability to work independently and meet deadlines. - .NET and are a plus but not a requirement. Prerequisites: For the long term project the *STARTING* wage will be as stated below. 1) Accept initial hourly rate of U$5.00 2) If awarded, accept and start work IMMEDIATELY 3) Have MINIMUM OF 20+ hours a week for long term ongoing support and development. 4) Work hours: predominantly 20:00 to 02:00 (UTC -3 Brazil TIME) 5) Be availabl...
...to all users online Must be able to upload the database (from local Microsoft Access) to web and re-enable the ability for entering data to users (online) When uploading database to web from Local MS Access, have to options. Update (update only changes. Overwrite records in web database), or Replace database on web (delete database on web and reupload from Access). Administrator must be able to import from Excel files into MS Access database (voters). When importing from excel to MS Access database (locally) then ms access database must be updated with the following rules: 1. When a record doesn’t exist in Access, but exist in Excel, create it 2. When a record exist in Excel and Access (based on field: EL_NO, UPDATED ALL FIELDS FROM EXCEL AND OVERWRITE ACCESS FIELDS except ...
We are in the middle of migrating Django to a new server. - Both servers run Ubuntu 20.04, postgres 12, python2.7 - The Django Project is already transferred over - Nginx has been configured - Postgresql has been setup Our struggle is to get the actual application up and running again. Your job will be to: - help to perform a clean export of the postgres database on old server - help to import the postgres database on the new server - ensure the Django application is coming back up smoothly The work will be done using shared tmate ssh sessions.
I am in need of a skilled professional who can a...the system to enable the creation of goods and service invoices in USD. - Implement moderate customization to the invoice templates, focusing on layout changes and adding custom fields. - Import all of my product information from an Excel sheet. This includes product names and their respective cost prices (which are in INR). - Enable and Teach me to Use Odd's OCR feature to fetch pdf data from invoice to transfer it to software Ideal Candidate: - Proficient in working with Odoo Books and setting up invoicing processes. - Experience with customizing invoice templates within Odoo. - Skilled in data import from Excel sheets to Odoo. I look forward to working with a professional who can deliver these requirements effect...
I'm looking for an expert to create a web-based CRM database aimed at efficiently storing and managing information. The data I intend to keep include: - Customer contact details - Sales history - Communication logs - Course details - Course Refresher notifications This project also requires the creation of functionalities to: - Add new contacts - Update existing contact information - Track sales performance Ideal freelancers should have substantial experience in CRM database development, with knowledge of implementing web-based solutions. Familiarity with training or course-based entities would be a bonus. Your expertise ought to allow seamless additions, updates, and performance tracking of stored information. Demonstrable success in similar projects will be advantageous. ...
I am in search of a skilled .NET Core developer to work on a project for me. As the client, I'm looking for someone who can bring the following to the table: - Proficiency in .NET Core: Given that my project is based on this technology, familiarity and experience with it is a must. - Application Development Experience: Previous experience in developing web applications would be particularly beneficial. - Strong Problem-Solving Skills: The ability to troubleshoot issues and devise solutions is key. - Attention to Detail: It's important that our project is implemented correctly and accurately. The ideal candidate for this project would be someone who understands the nuances of .NET Core, has a good track record in application development, and can work efficie...
I currently need an experienced industrial designer who can help me perfect a textile net for my product designed for basketball practice. Online, the main task will be to take the prototype of my existing product and make improvements through computing and then send it to be manufactured.
I have a small LinkedIn network of less than 1100 connections and 1500 followers. I'm looking for someone who can help me consolidate their details into a neat spreadsheet with their emails. Key Requirements: - Extracting email addresses: You'll need t...their emails. Key Requirements: - Extracting email addresses: You'll need to be able to extract the email addresses of my connections and followers. - Data presentation: Organize the data in a clear, logical manner which makes the spreadsheet easy to navigate. - Timeliness: I'm aiming for a quick turnaround on this project, ideally within 24-48 hours. Since I have explicit permission from my contacts to collect their emails, this project is ethical and should proceed smoothly. I'm looking forward to seein...
I have a iOS application with a few bugs that needs fixing and adding the function of inviting phone contacts to our app. iOS applicaiton built in: - Objective C - Native App and UIKit I will share the speciication document when we speak in freelancer chat.
Full Stack .NET Core Developer Needed to develop our whats app api platform A basic requirement is that he has previously worked on the WhatsApp API platform. I can review it before starting work
...freelancer who can help with B2B lead generation with a focus on the consumer goods sector. Key responsibilities: - Generate targeted leads: The main responsibility will be to find and gather leads specifically within the consumer goods sector. These leads should be from businesses, not from consumers themselves. - Specific decision-maker contacts: I need contact details for specific decision-makers within the consumer goods companies. These contacts should be the key individuals who play a role in making purchasing decisions. Ideal Skills: - Experience in B2B Lead Generation: A strong background in B2B lead generation is essential for this project. - Knowledge of the Consumer Goods Sector: A good understanding of the consumer goods industry will be a big advantage. - ...
I'm in need of an app developer who can create a straightforward, yet efficient application for both iOS and Android. Key Features: - User Portal: This will be the main entry point for users. It should be user-friendly and intuitive. - Document Import: Users should be able to import documents into the application. - Document Merging: The app should have the capability to merge documents. - Text Processing: The application should be able to process text. File Formats: - The app should support the following file formats for document import: PDF, Word (docx), and text files. The ideal candidate for this job should have: - Proficient in both iOS and Android app development. - Experience with document processing and merging. - Knowledge of file format compatibility...
...Linux staging server setup -> deploy our existing project to a new VPS using gitlab 2) Woocommerce -> continue long term development work on our existing custom plugin. Transfer the existing production woocommerce to this staging server. 3) ongoing long term development of our CRM app Other components of our stack which are a HUGE ADDED BENEFIT if you can work on them -> .NET ASP, WEB API + MS SQL DETAILS HERE -> PRIORITY IS TO HAVE A DEVELOPER ON OUR TEAM (LONG TERM) THAT CAN FOR NOW ALSO WORK WEEKENDS AS WE HAVE SEVERAL EMERGENCIES TO FINISH URGENTLY. Someone who can efficiently manage Linux VPS and efficiently use GITLAB is critical. Initially we need part of the hours to be worked in the first weeks from 8:00PM- 2:00am UTC -3 (Brazil Time) lat...
...AS WE HAVE SEVERAL EMERGENCIES TO FINISH URGENTLY. We will start with 5-10 small task in and then go to some smaller .NET tasks all with 1 day sprints for you to become familiar with the software and then our main goal will be to integrate another B2B API for our MVNO. Initially we need part of the hours to be worked in the first weeks from 8:00PM- 2:00am UTC -3 (Brazil Time) later you can work on your time zone. If you are awarded the task we expect you to accept IMMEDIATELY and if the project is not accepted immediatly we will award it to another developer. To qualify you must be full stack and work PROFICIENTLY with gitlab and code in ., .NET ASP, WEB API + MS SQL. We also have woocommerce and have developed and will continue to develop plugins, so PHP and...
...freelancer who can help with B2B lead generation, with a focus on the consumer goods sector. Key responsibilities: - Generate targeted leads: The main responsibility will be to find and gather leads specifically within the consumer goods sector. These leads should be from businesses, not from consumers themselves. - Specific decision-maker contacts: I need contact details for specific decision-makers within the consumer goods companies. These contacts should be the key individuals who play a role in making purchasing decisions. Ideal Skills: - Experience in B2B Lead Generation: A strong background in B2B lead generation is essential for this project. - Knowledge of the Consumer Goods Sector: A good understanding of the consumer goods industry will be a big advantage. -...
I am looking for a professional who can help me sell computer motherboards and other related equipment to IT departments in various businesses. The ideal candidate should have: - Prior experience in B2B sales, particularly in the tech industry - A network or the ability to establish contacts with IT departments - Familiarity with the industrial electronics market, including both new and used equipment - Good communication and negotiation skills - A proactive and results-driven approach to generating leads and closing deals Your primary responsibilities will include: - Identifying potential clients in the IT departments of businesses - Pitching our range of computer components, particularly motherboards - Negotiating deals and ultimately closing sales - Maintaining strong client re...
I want to design a car wash, and I want to import the goods from China, but I do not know what is the method, the best quality, and the method of communication. I want boxes for electric tanks that are made of carbon fiber, I want washing materials, I want water pumps, vacuum cleaners, all cleaning tools, and some other things. Ideal Skills: - Proficiency in Chinese - Experience with online dispute resolution - Strong communication skills - Understanding of international commerce and refund procedures
I'm looking for a skilled freelancer to develop a customized net worth spreadsheet. This spreadsheet should enable me to meticulously track my financial progress across various categories. Key Requirements: - The spreadsheet should allow me to input and monitor: - Investments (especially individual stocks) - Debt - Savings - Income - Expenses - Other category for miscellaneous expenses or income - I require a simple, user-friendly design that makes manual data entry easy and intuitive. Skills and Experience: - Proficiency in spreadsheet software such as Excel or Google Sheets is essential. - Experience in financial tracking and net worth management is highly beneficial. - Understanding of stock market, investment tracking, and basic accounting principle...
...taking existing Local government procedures and converting them into SQL based processes. An example of which would be creating a import procedure for traffic count data that is presented in a text format (example attached) Ideal Skills: - Experienced with MySQL Database Design - Well-versed in SQL coding - Ability to simplify complex instructions - PowerShell for anything not possible in SQL This project will demand creativity and intelligence to design procedures that simplify data entry processes. Please only bid if you can offer solutions according to the basic complexity level specified. This initial project will just be designing a procedure to easily import traffic count text files into SMSS via stored procedures, a PowerShell script or any process compatib...
Ho la necessita di configurare un importazione di prodotti con attributi collegati nella stessa pagina, la piattaforma da utilizzare e woocommerce con wp all import ( il caricamento dei prodotti e relativi attributi è stato gia fatto)
... to reach out to contacts and inquire about their clients, specifically business owners who may be interested in selling their businesses. Key Requirements: - Configuring : I am seeking a professional who can set up my instance of to effectively reach out to a wide network of professionals (accountants, financial advisors, bankers, wealth managers) with the aim to identify potential sellers among their clientele. - Contacting Professionals: Your role will be to utilize to establish contact with these professionals and to inquire about any potential business owners among their clients who might be interested in selling their businesses. - Handling Large Scale: You should be able to manage a large number of contacts and understand how to make
...has 15 columns. The column names are, in order: Shipment, Rush order, Mode of delivery, Drop sequence, PP number, Delivery date, Weight, Volume, Addressee, Name of addressee, Deliver address addressee, ZIP/postal Code, Delivery info, Number of cartons/units, Total ADR. The data is sorted using the “Mode of delivery” information, which allows deliveries to be grouped by truck. During the day's import, only lines with “Mode of delivery” information beginning with the letter Q should be imported. A SQL table will be created in the database. Each day, with each file sent, data will be added to the table. Key Responsibilities: - Develop a geocoding application in Node.js - Connect to a MySQL database to fetch addresses - Implement street-level accurac...
I'm in need of a customizable point-of-sale software tailored for my retail store. The software should offer various features including: - Import/export functionality: The software should support the import and export of products and customer data to enhance efficiency. - Scanning and printing receipts: I need the software to allow for scanning products and printing receipts with thermal printers. - User login for separate staff: It should also have a feature to allow separate logins for different users or staff members. - Inventory management: The software should include inventory management features for tracking stock levels and products. - Customer management: I need a system that can handle customer data and history, to help with marketing and future sales. - Tax ca...
...video calls. This is an urgent requirement and I need the project completed as soon as possible. Key Responsibilities: - Appointment Scheduling: You'll be responsible for coordinating my schedule and booking appointments on my behalf. - Video Calls: You'll be expected to conduct video calls with clients and partners on my behalf. Communication: - You should be comfortable communicating with contacts primarily through Skype. This is crucial in ensuring smooth scheduling and successful video calls. Ideal Candidate: - Previous experience as a VA, specifically in appointment scheduling and conducting video calls. - Excellent communication skills, both written and verbal. - High level of proficiency in using Skype. - Must be proactive, self-motivated, and highly organized...
Hello, I have my Python/Django site hosted on PythonAnywhere and it's facing a NET::ERR_CERT_DATE_INVALID issue. Website : I would appreciate someone help to troubleshoot this issue and fix the NET::ERR_CERT_DATE_INVALID error, ensuring that the SSL/TLS certificate is correctly set up. - Website troubleshooting and error resolution - SSL/TLS certificate configuration. Thanks in advance !
I'm seeking an experienced DevOps engineer who is proficient in deploying React Frontend and .NET Core 8 applications to Alma Linux with NGinx server. The candidate should have solid experience with: - Deploying React FrontEnd and .NET Core 8 Web API applications on Alma Linux in GoDaddy VPS. - Knowledge of routing of both applications with one domain and one SSL. - Knowledge of handling SubDomain. - Knowledge of Alma Linux Nginx deployment. - Understanding of .NET Core Application Settings and React.JS application settings - Understanding of Node.JS
Villa Silvana Building IFC Model with BlenderBIm Export Ifc and FBX. Ifc File import in UNREAL Engine and setup location map with Cesium plagin.
...across both iOS and Android devices. App name is FreshFlow. The registration is currently possible only in web part of the application: Specific features and functionalities of the mobile application that should be accurately targeted for testing include but not exclusively: - Login and registration - Push notifications - Search and CRUD operations on tasks, project, events, contacts, and tags To meet the requirements of our project, the ideal freelancer would have: - Proficiency in creating and managing automated tests for mobile applications, particularly Flutter - Experience in working with iOS and Android platforms, and optimizing tests for common iOS and Android devices - A thorough understanding of testing methodologies and best practices - Strong communication skills
Riabilia Building IFC Model with BlenderBIm Export Ifc and FBX. Ifc File import in UNREAL Engine and setup location map with Cesium plagin.
I'm looking for a Google Sheets expert to help me automate a process involving day by day data input process I'm seeking a freelancer who can streamline and automate the repetitive task of data import and export in Google Sheets. The ideal candidate should possess the following skills and experience: - Proficient in Google Sheets: You should have in-depth knowledge of Google Sheets and be able to manipulate data effectively. - Automation Skills: Experience in automating processes in Google Sheets is essential. Feel free to ask any questions, and please provide relevant examples of your past work. Thank you.
...able to communicate effectively. As our sales grow, your pay will grow accordingly. Responsibilities: - Send 75 personalized email outreach messages each day using pre-created templates. - Perform various tasks on LinkedIn to prospect and connect with potential clients. - Manage message sequences to engage with prospects and schedule consultation calls. - Maintain and build a database of email contacts and interaction details. - Check in with me daily to update on progress and ask for additional tasks. - Provide daily updates on tasks completed and check out before logging off. **Requirements:** - Previous experience with email outreach and LinkedIn prospecting preferred. - Excellent written communication skills and attention to detail. - Ability to work independently and meet ...
...com - Setup a series of team automated reminders and alerts that pertain to the status of a customer until customer is marked to be at a perticular stage in helpdesk - Setup helpdesk and make it work for our team - Integrate Odoo with 3CX phone system API to bring in phone records, create new leads or contact when a call is received, if possible also bring in call recordings from 3CX and put in contacts record, and call stats for each user of 3CX - Help create accurate reports in Odoo from sales, google ads, integration to Stripe payments, able to refund payments from witin Odoo for admin users/specific roles - Setup reports and dashboards that give insight into business and KPIs - The selected freelancer should have significant expertise in customizing Odoo's to fit a speci...
I need a skilled .Net MAUI developer to assist me with my existing project. The main tasks for this project include: - Fixing bugs: The project is currently experiencing some issues which are negatively affecting the user experience. The specific bugs are not provided in this brief, but I can share details during our discussion. - App Publishing: Once the bugs are resolved, you will be responsible for publishing the updated version of the app to both Android and iOS stores. - Delivery of the final source code and making sure it is running on our machine. The ideal freelancer for this project should: - Have a proven track record in debugging and resolving issues in .Net MAUI projects. - Be proficient in the publishing process for both Android and iOS stores and should b...
...tracking software, with specific attention to: - Inventory management: Ensuring that the software effectively tracks the inventory of returned products - Reporting & Analytics: Enhancing the software's capability to generate insightful reports about warranty returns. - User access control: Improving the control measures for different user permissions within the software. - Ticket creation, Data Import and Export: Aptitude in handling these features are considered a plus. The overriding purpose of this software is to track and manage warranty returns effectively. Ideally, you should have previous experience in software creation and maintenance for tracking and managing products. The purpose of this project would be Bug fixing and improvement of the software tool alrea...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
Setting up the quick book, import sales data, invoices and cleaning up to have ready to use
I have an Oracle database configured with WE8ISO8859P1 character set (call it DB1). The database needs to be updated to character set WE8MSWIN1252. I need to preserve the DB1 database, so I've created a new database with WE8MSWIN1252 (call it DB2). I would like someone to do this for me: 1. Export entire DB1 including data 2. Import the DB1 export into DB2 Communication and control will be done with Zoom
I'm looking to create a compelling web design for my HR company. The original website is here: NOT FOUND We need pleasant and intuitive user experience and modern web design. This is not a typical HR portal with open positions. Its aimed more les...slider with claim, menu and logo and some call to action button - 3 columns of services - like For Employees, For Employers, Consulting - list of open positions for employees, nicely designed - why to work with us, and some numbers (jobs per month / whatever) - about us - services provided - contact with ability to reserve meeting via Google Calendar - contact form - footer with some basic info (contacts, menu, socials) Very nice inspirations: - -
I have a PDF that is meant for email but I'm looking to convert it into HTML so that I can import it into MailChimp. The original PDF has a mixed layout with text and images. I need the resulting HTML to be mobile-friendly, professional-looking, and containing clickable links. Key requirements: - Convert PDF to HTML: The PDF contains a mix of text and images. I need this content to be faithfully translated into HTML. - MailChimp Compatibility: The HTML should be structured in a way that it can be easily imported into MailChimp. - Mobile-friendly: The HTML should be responsive and mobile-friendly to ensure a consistent experience across devices. - Professional Design: The resulting HTML should look professional and sleek, keeping in line with email marketing best practices. - C...
Ideal Skills and Experience: - Proficient in C# programming language and .NET framework - Experience in developing desktop applications - Familiarity with Visual Studio - Ability to implement data encryption and database integration - Expertise in developing secure user authentication mechanisms Please provide relevant examples of your previous work in C# desktop application development.
Setup of accounting software, import and clear data to have it ready to work.
I'm looking for a logistics sales executive who specializes in air and sea freight in the Chennai region. Main Tasks: - Develop and manage relationships in the manufacturing, export, and import sectors. - Target businesses who could utilize our freight services for their operational needs. - Increase brand visibility and leverage existing networks to generate sales. Key Skills and Experience: - Proven sales experience specifically in air and sea freight logistics. - Strong network within manufacturing, export, and import sectors in the Chennai region. - Excellent interpersonal, negotiation and networking skills. - Proactive with solid business acumen to identify new opportunities. The right candidate will have a sound knowledge of the logistics industry and be able ...
