Dashboard in vb.net punët
Creación de un dashboard admin con boostrap 4 que sea responsivo
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I'm in search of a skilled .Net mobile developer to finalize my .Net Maui mobile application. The key tasks include: - Implementing the logic, specifically around user interface interactions. - Although user authentication, data synchronization, and push notifications were not explicitly mentioned, familiarity with these aspects would be advantageous for potential troubleshooting or further development. The mobile application is already well underway, with views, and a nearly finalized backend. Therefore, I need a freelancer who is proficient in both .Net and Maui and can confidently complete the application. Ideal skills and experience: - Proficiency in .Net and Maui - Experience in mobile application development - Understand...
I'm in need of an experienced developer to provide long-term maintenance for my e-commerce website. The ecommerce is up and running and fully operational and we need a FULL STACK developer that can code in ALL AREAS of the webapp. - Frontend: React (JavaScript) - Backend: Node.js - Services: Python - Database: MySQL RESPONSIBILITIES: - Integration of new B2B APIs - New payment gateway integration - - Implementation of bug fixes and performance improvements. - Regular software updates and security patches. - Feature additions and enhancements. Skills and Experience: - Proven experience in maintaining e-commerce solutions. - Proficiency in React, Node.js, Python, and MySQL. - Strong problem-solving skills. - Excellent understanding of software best practi...
I'm looking for an experienced Power BI specialist to create a dashboard for me. The data that I would like to be integrated into this system is in an Excel spreadsheet. Key project requirements include: - Creation of a detailed and interactive Power BI dashboard - Integration of Excel data sources into the dashboard - Configuration of the system to ensure real-time data updates Ideal Skills/Experience: - Proficiency in Power BI, particularly in creating dashboards - Experience in integrating data from Excel spreadsheets - Understanding of how to configure real-time data updates in Power BI.
Ich bin auf der Suche, nach einer Agentur / einem Entwickler, welcher mir ein Tool / WebApp für Beratungsgespräche erstellt. In der Web-App sollen sich meine Kunden (Geschäftskunden) einen Account erstellen können und ihre Kunden (Endkunden) und Projekte verwalten können. Sie legen dort ihre Endkunden und Projekte an, die sie in verschiedenen Bereichen beraten können. Während der Beratung eines Endkunden können dort passenden Fragebögen aus einer Datenbank ausgewählt werden, oder eigene Fragebögen erstellt und ergänzt werden, zum Beispiel zum Thema „Vertrieb“. Im Kundengespräch werden dem Endkunden dann alle Fragen aus dem Fragebogen gestellt, wobei zu jeder Frage Stichpunkte zum folgenden Bereich no...
I am in need of an experienced and skilled developer to create a cryptocurrency betting website with a primary focus on sports. The website should cater to both desktop and mobile users. Key Requirements: - Develop a user-friendly and secure platform for sports betting using cryptocurrencies. - Ensuring the website is optimized for both desktop and mobile platforms to ensure seamless user experience. - Implement a simple, yet functional user account system. Ideal Skills and Experience: - Proficient in cryptocurrency integration and security to facilitate betting transactions. - Experience in sports betting or online gaming platforms. - Strong background in web development, with a focus on user interface and experience design. - Prior experience with developin...
We need the following features: 1. Login/ registration 2. Stripe integration 3. Place and order 4. After placing order, user can upload files to start project 5. Admin receives files from order. 6. Email no...order, user can upload files to start project 5. Admin receives files from order. 6. Email notification about order progress to user and admin 7. Admin uploads final report pdf to order and marks complete 8. User can download report from order page. End of flow. More details: What specific features would you like to include in the SaaS dashboard? User management, Payment processing, Upload and download files How do you envision the user interface of the SaaS dashboard? Modern and intuitive design What level of user access control do you need? Basic (e.g., ad...
I'm in need of a simple Android application that's centered around offline data storage. Consider it an offline simplified Instagram app: Dashboard gallery - has a + button that creates a post (see screenshot) - displays rows of 5 thumbnails (similar to Instagram) (see screenshot) Post A post can take 3 forms: - static weight text (ie. 71.3, ^0.5 - where the latter is the weight gained compared to the previous logged weight) (see screenshot) - a photo (see screenshot) - date (ie May 19) (see screenshot) Post interaction - Posts can be deleted or be created Gallery conditions - Displays rows of 5 thumbnails (see screenshot) - If it is the first post of the day, the gallery adds a thumbnail of today's date before adding the actual post (see screenshot) Post ...
I am looking for a professional developer to create a comprehensive and user-friendly dashboard for tracking my crypto investments. This won't be a public app. It's for my personal use only. I will provide the front-end elements (React) most of the work is for adding functionality and back-end. Key Features (I have API from CoinStats for these): - Real-time Price Updates: The dashboard should provide real-time updates on the prices of various cryptocurrencies. - Portfolio Balance Overview: I need to have a clear overview of my overall portfolio balance. - Transaction History Tracking: This feature will allow me to keep track of all my transactions in the crypto market. Additional Pages: - Indicator Tracking: An essential feature that should provide insigh...
I am in search of a skilled .NET Core developer to work on a project for me. As the client, I'm looking for someone who can bring the following to the table: - Proficiency in .NET Core: Given that my project is based on this technology, familiarity and experience with it is a must. - Application Development Experience: Previous experience in developing web applications would be particularly beneficial. - Strong Problem-Solving Skills: The ability to troubleshoot issues and devise solutions is key. - Attention to Detail: It's important that our project is implemented correctly and accurately. The ideal candidate for this project would be someone who understands the nuances of .NET Core, has a good track record in application devel...
I currently need an experienced industrial designer who can help me perfect a textile net for my product designed for basketball practice. Online, the main task will be to take the prototype of my existing product and make improvements through computing and then send it to be manufactured.
...interfaz de usuario de aproximadamente 10 pantallas (ver adjunto) de la aplicación a partir un diseño UX UI definido. • Se entrega el diseño UX – UI • La consulta de datos se realizará por API desde Postman • Trabajará en estrecha colaboración con el desarrollor back y UX UI para implementar un nuevo dashboard y mejorar la apariencia visual y la usabilidad general de estas pantallas. 1. Diseño de Login 2. Diseño de Inscripción de usuarios 3 pasos 3. Diseño o elección del Dashboard para su implementación (plantilla). 4. Implementación de grillas, paginación, ordenamiento y filtrado en las tablas de datos (Importante). 5. Permitir compartir pdf d...
I'm in need of a Power BI expert with solid experience in AI integration and advanced dashboard development. The project has multiple facets, including: - Data Cleaning and Transformation: The ideal candidate will have experience in working with large and complex databases. You should be able to clean and transform the data efficiently for integration into the dashboard. - Dashboard Design and Development: An eye for design is key. You will be creating a visually appealing and user-friendly dashboard, with the ability to customize as needed. - AI Model Integration: Extensive experience with AI integration is a must. You should be able to develop and integrate advanced AI models within the dashboard effectively. The main source ...
I'm in search of professional Sveltekit developers who can craft and style web components for my SaaS platform. We've already established the design theme, but the individual components need to be developed. Key Project Details: - Design Style: You'll be working on translating our design style into functional web components. - Number of Components: You'll be responsible for crafting less than 10 web components. - Integration: The components you create will need to be integrated with existing APIs. Skills and Experience: - Proficiency in Sveltekit: You should have a strong command of Sveltekit and experience developing custom web components. - UI/UX Design Understanding: While the design style is set, an eye for good UI/UX practices is appreciated for t...
Full Stack .NET Core Developer Needed to develop our whats app api platform A basic requirement is that he has previously worked on the WhatsApp API platform. I can review it before starting work
...social media accounts. • User accounts store personal information, trip history, and preferences. Operator Registration and Authentication: • Coach operators can register and provide details about their services, pricing, preferred locations, etc. User Dashboard: • Users can submit trip details including location, and passenger count. • Users receive quotes from multiple operators. • Users can view and manage their trip requests, quotes, bookings, and messages. • Chat functionality to communicate with operators. Operator Dashboard: • Operators can view available trip requests. • Operators can send quotes to users. • Operators can manage their accepted bookings, quotes, and messages. • Chat functionality to comm...
I'm in need of a skilled UI/UX designer to create a Hi-fidelity wireframe for my upcoming movie critics website. The site is set to serve movie enthusiasts of all ages, mainly adults, teenagers, and film enthusiasts. ### Project Scenario I aim to develop a website that functions as a MoviePageAsaService. This platform will enable users to publish their own movie critiques, reviews, and recommendations. The website will feature interfaces for registration and login specifically for critics. Once logged in, critics can create their own web pages within the main site, where they can upload movie posters along with comprehensive metadata about the movies. The homepage will showcase various top critics and their recommendations. General users can browse through these criti...
...am seeking a proficient dashboard developer to create a comprehensive and professional stock dashboard that will provide me with updated, real-time data and historical performance of approximately 50 stocks from both US and European markets. This dashboard will serve as my principal tool to track and manage my portfolio. Key Features: - Real-time stock data updates - Historical performance analysis for all stocks - Portfolio tracking for about 50 stocks Visual Design: - The design should be corporate and professional. I'm open to vibrant colors or minimalistic elements in order to easily visualice limit alerts. Ideal Skills: - Experience in both front-end and back-end development - Knowledge in financial markets, specifically NYSE, NAS...
...highly customized, advanced analytics reports in Sisense Dashboards with Blox coding. Your primary focus will be on creating a variety of customer reports, based on invoice data and analysis reports. Key Responsibilities: - Creating advanced, highly-customized customer reports using Sisense Dashboards - Leveraging Blox coding to enhance the reports with advanced analytics - Ensuring the integration of invoice data and analysis reports into the reports - Implementing appropriate visualizations and data representations for optimal understanding - Ensuring the reports are user-friendly and easily navigable. The ideal candidate should have: - Proficiency in Sisense Dashboard designing, with a strong command over Blox coding. - Prior experience in creating cust...
I'm seeking an expert in Excel analytics. This project involves working with existing but undisclosed business data to help me understand and optimize the business's performance through indicators like KPIs. The freelancer's task encompasses: - The creation of robust dashboards that effectively communicate KPI outcomes. - The execution of classification analysis to differentiate key data points. - Clustering the data into discernable patterns to aid business decision making. Ideal skills for this job include Excel proficiency, data analytics experience, and an understanding of key business metrics such as KPIs, dashboards, classification, and clustering. A background in business data analysis and the ability to assign meaning to raw data is desired.
...plugin. Transfer the existing production woocommerce to this staging server. 3) ongoing long term development of our CRM app Other components of our stack which are a HUGE ADDED BENEFIT if you can work on them -> .NET ASP, WEB API + MS SQL DETAILS HERE -> PRIORITY IS TO HAVE A DEVELOPER ON OUR TEAM (LONG TERM) THAT CAN FOR NOW ALSO WORK WEEKENDS AS WE HAVE SEVERAL EMERGENCIES TO FINISH URGENTLY. Someone who can efficiently manage Linux VPS and efficiently use GITLAB is critical. Initially we need part of the hours to be worked in the first weeks from 8:00PM- 2:00am UTC -3 (Brazil Time) later you can work on your time zone. Prerequisites: For the long term project the *STARTING* wage will be as stated below. 1) Accept initial hourly rate of U$5.00 2) If
...ALSO WORK WEEKENDS AS WE HAVE SEVERAL EMERGENCIES TO FINISH URGENTLY. We will start with 5-10 small task in and then go to some smaller .NET tasks all with 1 day sprints for you to become familiar with the software and then our main goal will be to integrate another B2B API for our MVNO. Initially we need part of the hours to be worked in the first weeks from 8:00PM- 2:00am UTC -3 (Brazil Time) later you can work on your time zone. If you are awarded the task we expect you to accept IMMEDIATELY and if the project is not accepted immediatly we will award it to another developer. To qualify you must be full stack and work PROFICIENTLY with gitlab and code in ., .NET ASP, WEB API + MS SQL. We also have woocommerce and have developed and will conti...
We have a webapp develped in nextjst and lavarel and we are seeking assistance with enhancing our platform, which connects different types of members. Our site offers various membership levels, including free, verified, and paid options, The tasks to be performed are: -Create a blog page and 404 page based on provided designs. -Integrate KYC verification proces -Email notifications based on members actions, covering various actions such as account creation, membership changes, and more. -Enhance the directory with filters, ordering options, and profile visibility settings. -Improve the registration process with email verification and social login options. -Enhance image management, including cropping, individual image uploads, and modal development. -Upgrade the "Blocked users...
...are seeking a Flask (Python) developer to set up a dashboard for our project using the following template: Please provide a quote for this job and an estimated timeline for completion. Objectives: We need a small application to facilitate user onboarding for our messaging bot. The dashboard will manage new user onboarding and offer basic administrative features. Dashboard Pages: • /signup • /signin • /forgot-password • /reset-password o Authentication logic with two roles: user and admin o Forget / Reset password logic required • /home o Accessible to logged-in users only o Displays bot updates and useful links o Updates data retrieved from the database • /profile o Accessible to logged-in users only o Contains a user pro...
I am seeking a professional developer to create a website for my business. Majority of Functions in user dashboard will interact with DB only
I require a freelancer skilled in survey design and impactful visual content to make changes to an existing electronic survey I have in Survey Monkey. Here is some insight into the specific tasks you'll be undertaking: - Update and enhance the current survey: This involves infusing fresh content by updating existing questions, introducing new questions, and replacing the current graphics. - Create an entirely new survey: This will include a mix of existing and new questions, along with logos and product images. The goal of this survey will be to gather customer feedback, so creating questions that retrieve valuable customer insights will be essential. - Build a survey flow and link answers for follow up automated EDMS and other forms of communication. - Survey resul...
...are F12Design, a platform where customers and designers come together and collaborate on graphic design projects. We would like to build an interactive dashboard to make the workflow simple and effective. Here are a few things on our mind: Languages - (Please free to suggest your own) Backend - PHP, jQuery, and SQL Frontend - HTML, CSS, and JavaScript For Real-time Demo/Example - Please sign up for and check their dashboard ########################################################## Social Login/Create account (Separate customer and Designer Login) ########################################################### Customer Dashboard Order Handling -------------- Past Orders Order Requirements (Quiz* and additional comments) Order Updates Order Delivery Date Order Tra...
I am in need of a comprehensive dashboard for my online chess academy. This platform will be used by coaches to monitor several aspects of our students' progress and academy administration. Key Features: - Student Progress Tracking: The dashboard needs to allow coaches to monitor individual student's progress over time. - Lesson Schedules: An integrated lesson schedule system should be included for coaches to manage and track the lessons being conducted. - Attendance Records: Coaches should be able to keep a record of student attendance using this dashboard. - Payment Calculations: The dashboard should have a feature that automatically calculates payments based on an hourly rate. Skills and Experience: - Proficiency in dashboard ...
...site and include a user-friendly dashboard with comprehensive sales data. Key Features: - Monitor sales from multiple teams at the same time, similar to the setup on Poppinpopcornonline.com. - User dashboard should display various metrics: * Total sales per team * Highest selling products per team * Breakdown of individual contributions per team and top three highest sellers * Top selling products for each team member * Ability for the individual team member to share their link via email and social media Ideal Candidate: - Proficient in Shopify development - Experience with integrating and/or building sales tracking tools - Skilled in creating user-friendly dashboards with detailed metrics - Familiarity with fundraising tools or sales tracking ...
Necesito generar deshboard y gráficos en Power bi desde 4 bases de datos • 1 base de dato en postgresql corporativa en aws • 1 base de datos en sqlserver en un servidor local • Google Analytics • Zendesk Son aproximadamente 50 gráficos personalizados con los que necesitamos hacer algunos dashboard de gestión. Es importante dejar documentado el trabajo y respaldadas las consultas en sql. Indispensable: • Dominio de Power BI • Experiencia previa en la creación de paneles para ejecutivos • Capacidad para integrar datos de bases de datos Indicar los accesos requeridos y los requerimientos tecnológicos para desarrollar el proyecto
I'm looking for an experienced Zoho developer to help with my Zoho CRM data analytics and dashboards. Key Responsibilities: - Develop a Zoho Analytics dashboard incorporating Sales performance tracking, Lead conversion analysis, and Customer segmentation. - Integrate Google Analytics Data and Google Adwords Data into the dashboard. - Create visual representations of the data using Bar charts, Line graphs, and Pie charts. Ideal Skills: - Previous experience working with Zoho Analytics and Zoho CRM. - Proficiency in integrating third-party data, specifically Google Analytics and Google Adwords. - Strong visualization skills, with expertise in Bar charts, Line graphs, and Pie charts. This project is crucial for me to understand my business performance, so ...
I'm looking for a skilled freelancer to develop a customized net worth spreadsheet. This spreadsheet should enable me to meticulously track my financial progress across various categories. Key Requirements: - The spreadsheet should allow me to input and monitor: - Investments (especially individual stocks) - Debt - Savings - Income - Expenses - Other category for miscellaneous expenses or income - I require a simple, user-friendly design that makes manual data entry easy and intuitive. Skills and Experience: - Proficiency in spreadsheet software such as Excel or Google Sheets is essential. - Experience in financial tracking and net worth management is highly beneficial. - Understanding of stock market, investment tracking, and basic accoun...
I'm in need of an experienced web app developer to create a Food Finder application. This app aims to help users discover nearby food spots and make informed decisions based on peer reviews. Key Features: - Location-Based Search: The app should enable users to search for food options based on their current location or a specified area. The system should provide accurate results and filter distant options. - User Reviews and Ratings: Users should be able to rate and review the restaurants they've visited. The overall rating and individual reviews should be openly accessible to other users. Compatibility: The app should be optimized for web browsers to ensure universal access. Ideal Skills: - Proficient in web app development - Experience in creating locati...
...Consequently, the ideal freelancer for this task should possess a strong proficiency in cloud-based software development, particularly those intended for construction project management. Your experience should also extend to designing user-friendly interfaces that cater to the needs of project management and administrative professionals. Web Application A cloud-based platform designed to streamline project management, financial tracking, and employee/subcontractor monitoring. Following are the list of each component of the platform along with the features it can offer: 1. Project Tracker This module will allow users to manage and track the progress of each construction project individually. Features: • Dashboard: Central hub displaying key metrics, status updates, ...
...assist me with my website. The project involves some custom work, particularly in the area of order tracking and user account functionality. Key Requirements: - User Registration and Login: Users should be able to sign up and log in using their Gmail or email id in addition to setting up a password. - Order Tracking: I need a custom dashboard that allows users to track the status of their orders. This feature should also enable manual entry of order updates by admin. - Downloadable Reports: Once a project is completed, users should be able to download a report related to the service they ordered. The ideal freelancer for this project should have: - Proficiency in Wordpress development - Experience with custom dashboard creation - Strong under...
Hello, I have my Python/Django site hosted on PythonAnywhere and it's facing a NET::ERR_CERT_DATE_INVALID issue. Website : I would appreciate someone help to troubleshoot this issue and fix the NET::ERR_CERT_DATE_INVALID error, ensuring that the SSL/TLS certificate is correctly set up. - Website troubleshooting and error resolution - SSL/TLS certificate configuration. Thanks in advance !
I'm seeking an experienced DevOps engineer who is proficient in deploying React Frontend and .NET Core 8 applications to Alma Linux with NGinx server. The candidate should have solid experience with: - Deploying React FrontEnd and .NET Core 8 Web API applications on Alma Linux in GoDaddy VPS. - Knowledge of routing of both applications with one domain and one SSL. - Knowledge of handling SubDomain. - Knowledge of Alma Linux Nginx deployment. - Understanding of .NET Core Application Settings and React.JS application settings - Understanding of Node.JS
I'm in need of a talented professional to craft a comprehensive social media dashboard that merges content from various platforms as well as non social media websites. This will include Facebook, Twitter, Telegram, blogs, and websites, as well as sites such as substack and Patreon. Key Features: - Combined Feed: The core function of this dashboard is to provide a unified feed of social media content. - Analytics and Insights: Your design should incorporate analytics and insights. I particularly prefer these to be presented in graphs and charts, allowing me to easily interpret data. Ideal Skills: - Proficiency in UI/UX design - Experience in social media integration - Strong understanding of data visualization - Knowledge of Facebook, Twitte...
...Additional Requirements: The platform must be responsive and developed using technologies such as PHP and HTML5, allowing full customization from the control panel. It must include a panel or dashboard from which I can upload more information, options, or videos in a personalized manner. Additionally, the exams should have a set maximum time. The platform must be scalable to add more training as needed. Ideal Skills and Experience: Experience with Learning Management Systems (LMS) or similar platforms Familiarity with developing and organizing training content, ideally by product type Proficiency in creating evaluation tools, such as multiple-choice quizzes Ability to automate the generation of PDF certificates based on quiz performance Speaking Spanish will be con...
As we are Manpower Supply Agency, We would like to incorporate attendance day to day entry of our workers from this info we would like to automate payroll, billing and Government salutatory. and also a dashboard for overall performance of our agency. Skills and experience: - Human Resources and Employee Management expertise - Ability to create user-friendly interfaces - Experience with Single Sign-On (SSO) integration and other login methods - Capable of adding features like search functionality, photo upload, and editable fields - Excellent communication skills to understand our needs and translate them into a functional system.
I'm in need of a wireframe design for a front-end dashboard tailored for school teachers. This dashboard will have a range of essential features, driving a seamless user experience for educators. Requirements: - Incorporate attendance tracking, grade management, and lesson planning functionalities - Develop a graphical design that displays the daily and weekly progress of each student in a bar graph format - Each student's picture should be displayed as a profile icon next to their name on the screens - A base design with each lesson (math, science, reading, history), and all the data is linked via Chatgpt (GPT) backend process with an API - Detailed customizable report generation process Ideal Skills and Experience: - Proven experience in...
In search of a Tally integration professional to add new features to our existing Web Portal system. I require suitably experienced person to integrate Invoicing and Billing, Inventory Management, and Financial Reporting within Tally. Key Task Requirements: - Work on the integration between Tally and our existing Web Portal - Implement user registration and login features - Create a dashboard for effective data visualization - Enable Tally integration for real-time data updates Ideal Skills and Experience: - Extensive experience with Tally and web portal integrations - Expertise with invoicing, billing, and inventory management systems - Proficiency in utilising financial reporting tools - Strong capabilities in creating dashboards for data visualisation.
As a student in my final year of Computer Science, I'm seeking a skilled freelancer to help me develop a web application. The project is a web based Pathalogy lab appointment booking system. In terms of the project's key functionalities, I'd like the web application to include: - User login and registration: The application should allow users to create accounts and log in. - Database integration: It is crucial for the system to store and retrieve data efficiently. - Responsive design: The application should be user-friendly and adjust well to different device screen sizes. Moreover, the application should have (CORE FEATURES OF WEBSITE):- - User Profile Dashboard: It should provide a personalized experience for users and allow them to manage th...
I need a skilled .Net MAUI developer to assist me with my existing project. The main tasks for this project include: - Fixing bugs: The project is currently experiencing some issues which are negatively affecting the user experience. The specific bugs are not provided in this brief, but I can share details during our discussion. - App Publishing: Once the bugs are resolved, you will be responsible for publishing the updated version of the app to both Android and iOS stores. - Delivery of the final source code and making sure it is running on our machine. The ideal freelancer for this project should: - Have a proven track record in debugging and resolving issues in .Net MAUI projects. - Be proficient in the publishing process for both Android...
...including job titles, descriptions, requirements, and application instructions. • Options to search and view job seeker profiles. • Tools for managing job applications include sorting, filtering, and communicating with applicants. • An analytics dashboard is used to track the performance of job postings and applicant metrics. 3.4 Communication Tools: • Integrated messaging system for communication between job seekers and employers. • Notifications for new messages, job applications, and other relevant updates. 3.5 Admin Panel: • Administrative dashboard for managing user accounts, job postings, and overall site content. • Tools for monitoring and moderating user activity, including content moderation and user support. 4. Non-Functional R...