Distance calcuation google map vb net punët
...migliori foto con scorrimenti automatici (slide); - realizzare la pagina "azienda" in cui ci saranno testi e foto che spiegano la storia dell'azienda; - realizzare la pagina "prodotti" e/o "servizi" in cui ci saranno testi e foto che spiegano i prodotti e i servizi dell'azienda; - realizzare la pagina "gallery" con tutte le migliori foto; - realizzare la pagina "contatti" con form di contatto e mappa Google; - eventualmente inserire collegamenti alle pagine social; - eventualmente sistemare le foto (con photoshop o altro software) per adattarle al tema e al posizionamento; - usare quanto più possibile i colori dell'azienda per i vari testi, menù, grafiche, ecc. Si prevede un lavoro che oscilla tra le 1...
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
check tha map ga hjf yaih;iohtwo gthjghou erherhyt5jjutyjtjy gkhjryjuryj hjtdhjtrutr ghhhktuc uktcfjtydjud jdtyjdyktukjuahn ntfjewatnyy54u dbbnjmrhgfhtyyerytrtrshtrshtrjstrjrytshgstrsthaeyhY3
check tha map ga hjf yaih;iohtwo gthjghou erherhyt5jjutyjtjy gkhjryjuryj hjtdhjtrutr ghhhktuc uktcfjtydjud jdtyjdyktukjuahn ntfjewatnyy54u dbbnjmrhgfhtyyerytrtrshtrshtrjstrjrytshgstrsthaeyhY3
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
Hi i Am Looking For Freelancer . To Ad 1 Google AdSense To My Websites.. PLEASE DO GET BACK TO ME I HAVE LOT OF WORK NEED DOING thank you soul
We're looking for a skilled developer who can execute integral changes to our website's Google API, which include: - Updating Location IDs: We need help with two main tasks: adding new locations and deleting old ones. The process of adding new locations will need to be done manually. Expertise in handling Google API and maps features would be highly valuable here. - Enhancing Google Search: Any experience with improving Google search results would be a significant advantage, indicating an understanding of SEO practices and how they apply to location-based searches. - Review Updates: Expertise in manipulating review-based APIs is required, as we aim to streamline our website's review integration process. Experience with database management would...
1) bharatiya nyaya sanhita 2023 pdf: 2) bharatiya nyaya sanhita pdf: 3) bns: 4) bharatiya nyaya sanhita: All backlinks will be for home page (root domain). Target URL: I want weekly and monthly work and backlinks report.
I'm in need of a proficient .NET Core developer, specifically experienced in working with the DICOM standard and utilizing the fo-dicom library. The primary goal of the project is to develop a new DICOM application, with the application intended to run on Web (Cross-platform). Key Requirements: - Advanced Understanding of DICOM: The ideal candidate should be well-versed with the DICOM standard, understanding its complexities and quirks. - Proficiency in fo-dicom Library: Experience with the fo-dicom library is a must. You should be familiar with its nuances and capabilities. - .NET Core Proficiency: You should have a solid background in .NET Core development, with a good understanding of its capabilities and limitations. - Web Development: As the application is i...
I'm looking for an expert in Google Ads to review my account. - I'm aiming to generate more leads, so I need a thorough analysis of why the account isn't performing as well as it used to. - I need you to compare the current state of the account to a previous time when it was delivering good results. - I need you to identify all the changes that have been made to the account since that time. - I need a detailed understanding of the effect of these changes on the account's performance. The ideal freelancer for this project would have: - Extensive experience with Google Ads - A proven track record of lead generation through Google Ads - Strong analytical skills and the ability to interpret data and derive meaningful insights - Excellent communica...
PROBLEM STATEMENT Development is being done on local environment without any staging environment, thus deploying on production may result in errors due to different configurations/libraries. SOLUTION Create a replica of EC2 production server (to be called "development") on AWS, that can be used for development and later for staging (once containerisation and CI/CD pipeline is configured) CONTRACTORS ANTICIPATED TASKS (high level): 1. Take backup of production instance on AWS. 2. Create new instance from the backup. 3. Configure and verify that code can pulled into the instance from bitbucket. 4. Setup required networking, database, monitoring, and Authorisation configurations. 5. Verify that the instance serves web application just like production and reflects any development...
...call for my Google ad campaign. The ad has already been created, this project specifically concerns the conversion tracking. - Business Name Setup: The business name needs to be set up according to Google guidelines. I'll provide the specific name for you to configure. - Website Conversion Tracking: I need conversions to be tracked via form submissions on my website. - Phone Call Tracking: Calls from Google Ads are to be tracked to a phone number on my website. Ideal Skills: - Proficient in Google Ad conversion tracking setup - Experience with Google ad guidelines and requirements - Strong understanding of website and phone call tracking - Attention to detail to ensure accurate tracking Your high-quality setup will be instrumental in measuring...
I have a Google Sheets file with a substantial list of 1007 products and I need this list to be organized into a final master list, integrating image links from two specific tabs. Key Tasks: - Create a final list of the 1007 products - Add the following details: CATEGORY, PRODUCT NAME, ABV, PRICE, Image Links - Integrate image links to the products from two separate tabs Ideal Skills and Experience: - Proficient in Google Sheets - Experienced with data organization and management - Strong attention to detail - Familiarity with handling a large volume of data in a systematic manner This project is time-sensitive and requires completion as soon as possible. A freelancer who can dedicate the necessary time and attention to ensure accurate and efficient completion would be hig...
I'm in need of a skilled developer who can create a sophisticated SERP analysis tool specifically for Google. - Your main task will be to develop a tool that can accurately analyze Google's search engine results pages (SERPs). - I'm looking for someone who has experience in developing software that can parse and interpret SERP data effectively. - While I'm not looking for a full suite of features, ensuring that the tool can provide a comprehensive SERP analysis is crucial. - The tool should be user-friendly, intuitive, and capable of generating clear and concise reports based on the analysis conducted. Given the nature of the project, expertise in web scraping and data analysis would be highly beneficial. Familiarity with Google's search algorithms an...
...Include: High-quality images of the villa and its amenities (logo and photos can be taken from our website ). A compelling tagline (e.g., "Experience Luxury by the Beach" or "Your Private Paradise Awaits"). Contact information (phone number, website, and social media handles). Colors and Fonts: Use sophisticated and inviting colors. Fonts should be clear and readable from a distance. Size and Format: The final design should be scalable to 16x8 feet and provided in high-resolution format (AI, PSD, or similar). Submission Guidelines: Submit your design in high resolution. Include a brief description of your design concept and how it aligns with the luxurious and exclusive nature of Villa Royale. Ensure your design is original and not infringing on any copyrig...
I'm seeking a professional who can assist me with populating a Google Sheets spreadsheet with text data from existing databases. This is for the purpose of conducting detailed data analysis. Key Responsibilities: - Locate and extract image links from existing databases - Ensure accurate and error-free input into the Google Sheets - Paste the image links into the right product row Ideal Skills and Experience: - Proficient in using Google Sheets and extracting data from databases - Strong attention to detail to ensure data accuracy - Familiarity with data analysis techniques is a plus - Ability to organize and structure data effectively for analytical purposes I'm looking for someone who can work efficiently and provide high-quality results.
I'm in need of a skilled developer who can create a Windows GUI application. This app should be capable of opening and editing a pre-formatted CSV file. Key Fe...walkthrough. Ideal Skills: - Proficiency in Windows GUI app development - Experience working with CSV files and handling user inputs - Strong understanding of UI/UX design, especially in creating professional and corporate visuals - Ability to deliver a straightforward and intuitive user experience - Strong communication skills for clarifying any requirements during the development phase. The net result will be a simple app to edit a CSV file before it is uploaded to a copier. We are tired of using a text editor to maintain a copier address book. This format is specific to Ricoh's. Demo Export Attached. Key inc...
I'm in need of a Python GUI software to automate sending messages through Google Voice. The software should be able to perform the following functions: - Send messages to individual contacts on Google Voice - Support precise date and time scheduling for these messages -Automated Sending with customized message example: message example {name} and {adsress} -Custom delay settings for each message -Multiple Profile Sender (custom threads) with multiple Proxy support (enable/disable proxy) -Auto login accounts - Auto Skip Terminated Accounts -License system for users -Sending reports Ideal Skills and Experience: - Proficient in Python programming - Experience in developing GUI applications - Familiarity with Google Voice API is a definite plus - Strong understandin...
I'm in need of a writwr who can write a report on BNG and also use metric calculator
IMPORTANT FOLLOW THE SHORT YOUTUBE TUTORIAL I'm looking for a skilled Unity developer to create a small terrain for me. It's essential that this terrain is made with a provided image as the heightmap. I can also provide a tutorial of what is needed to be done using the heightmap i will provide The terrain is small, I'm not looking for anything too complex at this stage. i provided a raw image in case this dont work you can make one from the png In terms of environmental features, I would like a plane as the water body as a separated object. Ideal skills and experience for the job include: - Proficient in Unity with a strong background in terrain design - Ability to work with provided images for heightmaps - Strong understanding of texturing and color creation for terrains...
Post a testimonial on Google Business Link below from the Text file along with your own comments from ChatGPT. Google Maps link: Multiple Winners possible!!
I'm seeking a Power BI expert to create a Territory Map of both Zip and State. Key Project Requirements: **Mapping:** Your task involves creating the map with both zip and state information. **Data Update:** The map should be updated periodically, not in real-time. I'm using ARCgis in Power BI to create maps. I can create a good map based on zip codes, or based on state, but I can't seem to figure out how to combine the two. Our CA territory is divided by zip code, but some states are considered one territory. So, I need to apply first a filter by zip code, and then a layer based on state on top of that. Attached is the territory map by zip code that I created with Power BI. I need it to look like that but with New Mexico, Arizon...
I'm seeking a professional to build a system that creates aggregates Google business ratings for security installation services and Reviews for my site pages. Key Requirements: - Aggregating Business Ratings: The system should specifically focus on collecting the business ratings of security installation services available on Google. Data Points: The key data points that need to be collected include each business's overall rating and star reviews listed on Google SERPs. for Ideal Candidate: - Proficient in Web Scraping: Experience extracting and aggregating data from websites is essential. - Familiar with Google API: Knowledge of Google's API for harvesting ratings and review stars would be a plus. - Data Analytics Skills: Ability to process...
Necesito a alguien que tenga 20 teléfonos con cuentas gmail, para participar durante 14 días como testers de una prueba cerrada de Google play. Con la finalidad de pasarla a producción lo antes posible.
...create a fully responsive, user-friendly website for my moving company. This project involves a comprehensive set of requirements, including: - Service Details: The website should showcase our key services, including packing and unpacking, furniture assembly and disassembly, and courier services. - Pricing Calculator: The site should feature a sophisticated pricing calculator that accounts for distance-based and volume-based pricing. The calculator should be intuitive and easy for users to interact with. - Booking and Contact Forms: We need easy-to-use forms for customers to book our services and get in touch with us. - Security Features: Security is a top priority. The website should include SSL encryption, user authentication, firewall, anti-malware protection, two-factor auth...
I'm in need of an exceptional illustrator with a deep love for the style found within J.R.R. Tolkien's world. My project is a small detailed real world map incorporating iconic landmarks in the manner Tolkien. The design should include the following: * Iconic landmarks: I'll provide these in a screenshot * Detailing: Mountains and hills on the map should be moderately detailed showcasing basic shapes and elevations, as well as canals and paths It's crucial that you're able to replicate elaborate Tolkien-style calligraphy as this style is synonymous with his work. Experience with fantasy cartography would be a great bonus.
I'm in need of a .NET Core developer to create an appraisal system. This system is designed to implement multi-page functionality. The system should be robust and user-friendly, ensuring a seamless user experience. Your primary task will be to build the system according to the provided guidelines. The appraisals can be conducted by the user without the need of connecting to any existing software or databases. Ideal Skills and Experience: - Proficiency in .NET Core - Experience in developing multi-page systems - Strong understanding of user authentication - Familiarity with document uploading - Competency in creating rating and feedback systems The project does not involve any integration with existing software or databases. You will be working on building the appraisal...
...launch a Google and Meta Ads campaign, with the primary objective of generating more leads and sales for my business. The focus will be on a nationwide scale, giving our campaign a wide reach across the country. Here is what I specifically need for this project: - Ad Campaign Development: Coming up with effective Google and Meta ads that specifically target a certain age group to generate leads and sales. You'll need to craft compelling ad copies that can attract and engage this demographic. - Ad Campaign Management: It's not just about creating the ads, but also about managing them. The ideal freelancer should have excellent monitoring skills to ensure our ads perform optimally, making necessary tweaks and adjustments on the go. Skills and Experience: - Ex...
I'm looking for a Google Shopping expert who can help me boost the conversion rate and sales of my WooCommerce e-commerce store. My Store selling is Ayurvedic medicine men's category. Key Points: - The current conversion rate and sales volume of my store is low. I aim to significantly improve both. - The primary goals of this campaign are to increase my store's conversion rate and sales. Ideal Freelancer: - Experience with Google Shopping campaigns. - Proven track record of improving conversion rates and sales for e-commerce businesses. - Proficient in WooCommerce, as my store is built on this platform.
I'm looking for an expert in .Net 8 Blazor to enhance our RIS (Radiology Information System) application with several new features, specifically focusing on workflow automation. Key Features to Add: - Workflow Automation: This includes automating the patient registration and check-in process, radiology order entry and tracking, as well as results distribution and notification. Ideal Candidate: - Proficient with .Net 8 Blazor framework - Experienced with Radiology Information Systems - Skilled in workflow automation - Capable of building secure and scalable systems - Understanding of healthcare industry regulations and standards If you have the expertise and experience in these areas, please reach out to discuss this exciting project!
I'm in need of a virtual wedding invitation that will not only display the location of the wedding but also provide general information about the event and showcase a selection of photos. The key features and design elements I'm looking for are: - A digital map that can show the location of the wedding. Additionally, I would like the invitation to include a section for general information about the event and a gallery where guests can view a selection of photos. - My preference leans towards a modern and minimalist aesthetic. The overall design should be simple, sleek, and elegant, using colors such as Neptune, Dusty Blue, Sage Green, Gray or Brass. In addition, the invitation should also incorporate an RSVP function. I prefer the RSVP to be managed through a form th...
I'm looking for a skilled professional to help me set up Google Ads for my WordPress webpage. Key Responsibilities: - Setting up Google Ads account for lead generation - Identifying the best keywords to target - Creating compelling ad copies - Monitoring and optimizing the campaign for maximum lead generation I need someone who has: - Proven experience in setting up Google Ads campaigns, especially for lead generation - Extensive knowledge of WordPress and its integration with Google Ads Please be ready to show examples of past successful campaigns. Your insights on strategy and proposed budget are welcome. Thank you in advance.
I am looking for a proficient PPC manager who has in-depth knowledge and experience with Google Ads. The ideal candidate possesses: - A strong understanding of Google Ads platform - Mastery in sales-oriented PPC strategies For this project, the focus is on the retail sector. Key responsibilities will include: - Planning and implementing Google Ads campaigns targeted at my specific audience - Turning the PPC campaigns into revenue-generating strategies - Monitoring campaign progress, adjusting tactics as required to maximize results If you have excelled in similar roles in the retail sector and enhanced ROI by generating sales or leads, I'd love to hear from you.
THE PROJECT MUST BE DONE ON MS VISUAL STUDIO - MY BUDGET IS $30-50 , ANYTHING MORE THAN THAT DON'T APPLY. ALSO TIMEFRAME IS 4 DAYS I'm seeking a skilled .NET developer to design an efficient, user-friendly inventory management system for a luxury shoe shop. 1. The Project should have/do the following: a. Product screen • Add product • Edit product • Delete product b. Category Screen • Add Category • Edit Category • Delete Category c. Subcategory Screen • Add Subcategory • Edit Subcategory • Delete Subcategory d. User Screen • Add User • Edit User • Delete User e. Edit Stock Screen • Add Stock Amount of Each product • Edit Stock Amount of Each Product 2. There should be a database for each screen 3. I...
I'm looking for an SEO expert who can guarantee that my website moves to the first page of Google search results. Key project requirements include: - Currently, my website is not ranking on the first page of Google. - I'm specifically looking for both on-page and off-page SEO services. Ideal candidates should have: - Proven experience in moving websites to the first page of Google. - Expertise in both on-page and off-page SEO. - A solid understanding of the local market to help reach our target audience. Please provide examples of previous work and your strategy for achieving this goal.
I'm looking for a professional to help me fix my sitemap on Google Search Console. Currently, I'm experiencing two issues: “Missing URLs in sitemap” and “Errors in sitemap.” Key Project Details: - Less than 10 pages are currently missing from the sitemap. - There have been no recent changes to the website that could have affected the sitemap. Ideal Freelancer: - Must have experience in resolving sitemap issues on Google Search Console. - Should have a good understanding of website structure and indexing. - Proficient in identifying and rectifying errors in the sitemap. - Strong communication skills to explain the resolved issues and ensure future sitemap stability.
I'm in need of a skilled designer who can take my content and branding elements and craft them into a visually stunning presentation. Key Requirements: - Google Slides: The format of the slides must be on Google Slides - Client Pitch: The primary purpose of these slides is to pitch to potential clients, so it's crucial they're engaging and convincing. - Creative and Engaging: I want the slides to be not just professional but also creative and visually captivating. Ideal Skills: - Proficient in Google Slides - Strong design skills, with a portfolio that demonstrates creative and engaging design - Understanding of client pitch presentations and how to structure them for maximum impact If you're a designer with a knack for creating persuasive, vi...
Keil Business Solutions GmbH is an innovative Google reseller and IT service provider. For a customer project we are currently looking for a Senior SAP PP Functional Consultant for TKE project (f/m/d) - Spain Roles & Responsibilities: • Facilitate the implementation and support of SAP PP ECC Roll-outs. • Perform detailed analysis of complex local business process requirements and provide appropriate system solutions; identify, interpret, validate and document customer requirements. • Facilitate workshops to collect local business requirements. • Map client business requirements, processes and objectives; develops necessary product modifications to satisfy clients' needs. • Design, customize, configure and testing of PP. • Identify gap...
...corporate logos and branding materials. The designed logo and branding materials should communicate professionalism and be instantly recognizable. The message thematically tied to the logo should embody clean energy, environmental preservation, and prosperity while highlighting the concept of a new era of re-industrialization in responsible stages of readiness and gradual decarbonization, aiming for Net Zero between 2030-2050, but also centred around freedom to choose, reliability and self sufficiency. Also, the design should symbolize Energy Transition, Innovation, and Best Practice while promoting Responsible Citizenship, Stewardship, and Affordability. Ideally the logo communicates the best value for both industrial and commercial customers, emphasizing an optimal cost-quali...
...corporate logos and branding materials. The designed logo and branding materials should communicate professionalism and be instantly recognizable. The message thematically tied to the logo should embody clean energy, environmental preservation, and prosperity while highlighting the concept of a new era of re-industrialization in responsible stages of readiness and gradual decarbonization, aiming for Net Zero between 2030-2050, but also centred around freedom to choose, reliability and self sufficiency. Also, the design should symbolize Energy Transition, Innovation, and Best Practice while promoting Responsible Citizenship, Stewardship, and Affordability. Ideally the logo communicates the best value for both industrial and commercial customers, emphasizing an optimal cost-quali...
As a business professional, I'm looking to hire a freelancer experienced in Google Ads and Google Shopping Ads to help me boost product sales with a focus on the adjustable pedestal market. Key Responsibilities: - Develop and implement a targeted advertising strategy to reach a B2B audience effectively. - Optimize Google Ads and Google Shopping Ads to drive conversions and boost product sales in the adjustable pedestal industry. - Provide regular reports and analysis on the performance of the campaigns. Ideal Skills and Experience: - Proven experience in managing Google Ads and Google Shopping campaigns, with a focus on the B2B market. - Solid understanding of the adjustable pedestal industry and its audience. - Ability to optimize ad campa...
I have a Google My Business listing and am striving to attract more customers. I'm looking for someone to help me increase my Google Business reviews. Key Responsibilities: - Formulate a strategy for increasing reviews - Implement the strategy effectively - Monitor and report on the progress Experience: - Proven track record of increasing Google Business reviews - Strong understanding of digital marketing and customer engagement - Excellent communication and people skills Please note that I am not currently encouraging customers to leave reviews.
I need an expert in Google My Business to assist in optimizing my existing business profile. I am looking to improve the business information section of my profile. Specifically, I am interested in optimizing the following areas: - Business Description - Operating Hours - Contact Information - Product or Service Details The ideal candidate would come with a wealth of knowledge on how to fully optimize a Google My Business profile to make it more engaging and visible to potential clients. Experience in SEO, digital marketing, and Google's ranking algorithm will be greatly appreciated. Excellent communication skills will be essential, to understand my needs and objectives fully before making changes to the existing profile.
I am looking to develop a Variable Message Sign (VMS) software. The software should be: - Compatible with Windows - Able to facilitate message scheduling and display - Support remot...the clients added. The user Manual for the software is attached, Please Go through the manual and get Details. For the software demo, please access: ViPlex 64 bit: (X64).zip 32bit: This project requires a skilled .NET developer with experience in developing software for the Windows platform. Previous experience with traffic management software or VMS systems would be a great advantage. Please provide a relevant project portfolio.
I'm seeking an experienced Laravel developer to customize two Laravel apps I'm considering purchasing. The primary task is to enhance the "Users Nearby" map feature in both apps: 1) The current "Users Nearby" Map option displays users locations but we need to add so it displays live geolocation. (So when the user moves, it moves in live time on the map) 2) Add subscription option for users (Pay monthly which unlocks options). 3) Add a couple of custom fields within the profiles. The Laravel apps that we are purchasing are at the following link, you can download the APKs there too. Please read the above first before bidding please. Thanks in advance.
I'm looking for a seasoned freelancer to manage a Google ads campaign to increase both my website traffic and generate more leads. Here's what you should ideally have: - Proven experience in Google Ad campaigns - Expertise in audience targeting, specifically working professionals aged 25-40 - Understand local ad targeting, as this campaign is focused on a specific city or state - Can convert ad viewers into potential leads A comprehensive understanding of Google Ads algorithms, platform, ad optimization, and local targeting is a must. Bonus if you've worked in generating leads for businesses. Your goal will be to ensure our ads reach the appropriate target audience within our specified geographical location, thus maximizing opportunities for website tr...
I am currently seeking a skilled and experienced C# developer with expertise in the .NET framework. The primary task at hand is to implement advanced background job features within the project, with a specific focus on Asynchronous Processing and Queue Management. Key Deliverables: - Implement Asynchronous Processing: The developer should be able to design and implement a system where tasks can be processed concurrently, allowing for better performance and resource utilization. - Implement Queue Management: The project requires a developer who can set up a robust queue management system, ensuring tasks are executed in the correct order and at the right time. Specific Requirements: - Maximum Queue Size: The system needs to be designed with scalability in mind. You should be able ...
I'm in need of a skilled developer who can build a .NET middle layer for me. This layer will be responsible for calling an external API and handling the responses in a JSON format. The requirement is to design the system in a way that the output is stored in a JSON file. Key Requirements: - Build a .NET middle layer for API calls - Handle API responses in JSON format - Save the output in a JSON file I need this layer to be manually triggered on-demand. This is a crucial aspect of the project, so reliability is key. Ideal Skills: - Proficiency in .NET development - Experience with APIs, especially handling JSON data - Ability to design systems for manual triggers Experience in similar projects is a big plus, so please provide relevant examples in your proposa...