Library management system project in vb net punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
, & are three very successful websites that sale high quality custom clothing labels in small quantities to several thousand SME as well as individuals who need to mark clothes with great good looking labels of professional quality. Since 2011, the business has enjoyed a steady growth of happy customer and an excellent track record of sales. Following this success we are now expanding to Russian speaking customers via a new website targeting Russia, Ukraine, Belarus and EU Baltic states such as Estonia, Latvia and Lithuania. We are seeking a dynamic eCommerce Manager to assure success again. Location: For training purposes, preferably (and initially) the ideal candidate should be based close to Tallinn, but this can be discussed. However
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
nhjkmbjkgugyufyufykjkhiu kiuy7yubnbjhggggghutyurrtr lbhrffyyffdfhbjjhgyfgjkgggnjhjvdrtstghjgszzxfvhjjhgjhjjsrdfjpooouiuyui
nhjkmbjkgugyufyufykjkhiu kiuy7yubnbjhggggghutyurrtr lbhrffyyffdfhbjjhgyfgjkgggnjhjvdrtstghjgszzxfvhjjhgjhjjsrdfjpooouiuyui
I need a Python developer who can create an automated IME barcode system. The system should handle bulk entries and generate images. Barcode experience is essential for this project. Key Requirements: - Handling of Code 128 and IMEI barcode types - Generating barcode images in PNG format - Capability to handle bulk entries, preferably through CSV file uploads The ideal candidate should have: - Proficiency in Python - Experience with barcode generation and handling of bulk data - Familiarity with handling CSV files in Python This project is suited for someone who is detail-oriented and has a strong understanding of automation and barcode systems. Please apply if you have the required skills and experience.
I'm in need of an experienced freelancer who can build a ticket sale system for my nightclub and festival events. The main features are: - **Selling Tickets**: The primary purpose of this system is to facilitate the sale of tickets for events. The system should be able to handle large quantities of tickets, as well as different ticket types (e.g., VIP, Regular, Early Bird). - **Digital Ticket Delivery**: Users should be able to receive their tickets through digital download. This requires a secure and user-friendly interface for ticket delivery. - **Event Variety**: The system should support multiple types of events, in this case, nightclubs and festivals. It should have a user-friendly interface that accommodates the unique requirements of e...
I have built a website myself. I like the text but the design is too basic. https:...want a re-design of this site, reflecting a modern and eye-catching design for blue-chip clients. Our clients are those that work in facilities management, apartment management and commercial cleaners for office buildings. Layout Header section 3 Key highlights Contact Us All info on a single page I like a header section with transparent header, text overfull length images and transparent boxes (roughly like the image provided). Under our 3 highlights, I want a basic but eye catching 'Contact us". Deliverables I want to see 3 different design mock-ups prior to doing anything to the live website. Once design is chosen and approved, site needs to be bult in Eleme...
I'm in need of a skilled web designer to build an informational website tailored towards professionals. The primary content will be centered around detailed information pertaining to various professional services. I envision a streamlined, user-friendly interface that embodies a professional aesthetic. The ideal candidate for this project would: - Have a strong background in website design and development - Be proficient in content management systems and coding languages - Have an acute understanding of how to cater to a professional audience - Pay great attention to detail when translating professional service descriptions onto a digital platform In addition, freelancers with experience in SEO and mobile-friendly design will be given...
I'm looking for an experienced Community Manager to focus primarily on two of our main platforms: Facebook and Instagram....experienced Community Manager to focus primarily on two of our main platforms: Facebook and Instagram. Key Tasks Include: - Developing fresh and engaging content - Managing ad campaigns effectively The ultimate goal of this project is to generate leads and increase our customer base, so experience in conversion optimization strategies is a plus! Ideal Candidate Skills & Experience: - Proven track record in community management - Excellent content creation abilities - Experience in managing social ad campaigns - Proficiency in lead generation tactics Your success in this role will directly impact our comp...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
I have recently completed the installation on AWS EC2 for my Mifos Fineract. I want to ensure these systems are correctly s...generated from the database. An understanding of how to utilize this plugin is essential for this job. - Account Setup: I am also wanting assistance with setting up basic accounting for savings, loan and FD/RD. Familiarity with accounting principles and experience using cloud-based financial management systems like Mifos Fineract is highly desirable. Ideal candidates will have experience with Pentaho, Mifos Fineract and AWS EC2, and be able to demonstrate effective communication and time management skills. Your ability to provide clear instructions on how to operate these systems once setup will be highly regarded.
As the owner of a flourishing business, I'm in need of an accomplished marketing manager. The priority tasks include: - Managing our social media platforms effectively to engage with our target demographic, which consists mostly of middle-aged adults and older people. - Developing and implementing robust advertising campaigns that utilize appropriate channels to reach our target audience. - Undertaking insightful market research to understand current trends and preferences of middle-aged adults and older people, and adjusting marketing strategies based on this data. The main goals of our marketing efforts are: 1. Amplifying our brand's presence and making sure it is top-of-mind for our demographic. 2. Driving significant traffic to our website. 3. Generating qualified l...
I'm seeking a Jira expert to help with various aspects of our Jira platform. Although I'm not sure about the specifi...and streamline our processes. - User permissions setup: Our current user permissions need to be reviewed and adjusted. We need a clear, secure and logical system in place. - Configuration of issue types and fields: We require the creation and configuration of new issue types and fields to better fit with our project management needs. Ideal candidates will have extensive experience with Jira administration, particularly for larger teams. It's important to have a strong understanding of Jira's capabilities and how to tailor them to specific business requirements. A proven track record in workflow customization, user per...
I'm looking...integrate my 1.8 PrestaShop with Sage. I've already got an existing Sage integration module in place. Key Tasks: - Product Synchronization: I need the product data on both platforms to be synchronized seamlessly. Any changes in product details, stock levels, etc., should be reflected in both systems. - Order Management: I need the order processing to be automated and streamlined. Orders placed on PrestaShop should be automatically reflected in Sage for efficient processing. Ideal Skills and Experience: - Proficient in PrestaShop and Sage integration. Experience with version 1.8 of PrestaShop would be a plus. - Strong understanding of product synchronization and order management processes. - Prior experience in...
Hi, we are a nonprofit based in Brazil. I am seeking a freelancer with outstanding research and data management skills to compile a list of geographical location of (environment and social) projects supported by a set list of 300 UK foundations (attached). Key Responsibilities: - I am only interested Foundations that provided grants to Brazilian organizations in the past 3 years (so the final list will be considerably shorter) - For these, I would need to know what are the themes covered by the foundation (for those grants but also beyond) - For some of these (that we will select later), I would need the email of the grants manager in charge (process wise, if it is easier to get te email of this entire subset, that’s ok) If a list of themes can be ...
As a driven individual, I'm seeking an experienced software developer who can build a sophisticated algo trading software. Key Requirements: - Proficiency in Python and Java. Your proven experience in these languages will be crucial to the development of this software. - Openness to both web based and desktop applications. As I am still in the deciding phase, we can discuss which approach best suits my needs during the proposal phase. - The software must include automated trading strategy execution and risk management tools. Your understanding and experience in these aspects will be paramount. Looking forward to a successful collaboration.
Immediate need for a developer who can assist internal team complete short assignments of LMS (Learning Management System) development. Should be competent in jQuery and Laravel for a project built on MySQL database.
I need someone experienced in social and ppc marketing with a proven history of generating leads and working to a budget. I work in the financial niche where leads are fairly easy to generate but ppc will take management. Thanks
I'm looking for a Social Media Manager who can help me craft and execute a...with potential employees and publish job listings - Running advertising campaigns to enhance lead generation on Facebook I'm seeking an experienced individual who: - Has a proven track record in Social Media Management - Demonstrates creativity and a keen understanding of lead generation strategies on Facebook - Possesses experience with LinkedIn recruitment and employer branding - Can provide examples of successful campaigns and content they've managed - Is able to understand and adapt to the unique needs of our industry Ideal candidates will have a portfolio or case studies showcasing previous success in lead generation and recruitment through social media. A good understand...
I urgently require a freelancer to create a logistics management system for my business. The system must address the issues I'm currently facing with tracking shipments and managing inventory. Key Points: - The system should be able to efficiently track shipments and provide real-time updates. This is crucial to improve our customer service and overall business operations. - The inventory management module should be effective and user-friendly. As a business with 18 warehouses, we need to ensure all stock levels are accurately and efficiently maintained across all locations. Skills and Experience: - Proficiency in logistics software development - Strong understanding of inventory management systems - Prior experience with large wareho...
I'm looking for an experienced developer to help me fix a few issues with my CodeIgniter website. The website is running slow and throwing error messages, with several key features not workin...ensuring it works as designed - Restoring the search function to full functionality - Repairing the payment processing feature and ensuring it functions correctly Ideal candidates should have: - Proficiency in CodeIgniter with a proven track record of successfully repairing websites on this platform - Strong debugging and problem-solving skills - Excellent understanding of website functions and features - Strong time management skills and the ability to work under tight deadlines If you believe you have the skills and experience necessary to handle this project, I'd ...
Electronic case filling system for justice system in my country
I need a responsive webapp. I would like it designed and built.
I'm looking to significantly enhance my online presence through an effective, targeted social media campaign on Facebook and Instagram. The primary objectives of this campaign are to: - Exp...Drive more traffic to my website - Increase online sales and conversions Additionally, I require skilled assistance for setting up and managing a Google merchant account for my bag product line. A specialist with a proven track record in social media marketing and Google merchant accounts will be ideal for this project. They should possess: - In-depth knowledge of Facebook and Instagram advertising - Proven experience in boosting conversions and web traffic - Understanding of Google merchant account setup and management - Expertise in marketing for p...
I'm aiming to create a beginner-level educational webs...focusing on the AWS EC2 service. This is an individual project with an objective to learn and teach AWS technologies. Key tasks are: 1. Website Development: - Build an informative and user-friendly website. - Experience in educational website creation is preferred. 2. AWS EC2 Teaching Material: - Develop easy-to-understand content covering basic AWS EC2 topics. - Hands-on AWS experience is necessary, especially with the EC2 service. 3. Log Capture & Processing: - Configure logs to be captured in Wireshark, processed in Splunk. - Experience in Wireshark and Splunk would be beneficial. Freelancers with a teaching background in technology, AWS expertise, and experi...
We need to detect if the axle is in the hinge or not with probablility of 99.9% at least. We need ready Python code that we can insert into our main routine. Recognition part gets image to process and returns result. Data set is available here: The system must perform object detection, with a critical requirement for real-time operation. Key tasks and requirements include: - Develop a high-precision hinge detection system, using Python programming language. - Implement object detection algorithms, ensuring accurate and real-time detection capabilities. - Ensure the system operates in real-time, with minimal to no delays in processing. - Utilize computer vision best practices to enhance the system's performance and accuracy
I'm in need of a professional who can review and optimize my .net Core 6 codebase, enhance the software architecture, and bolster the database security. Key Responsibilities: - Conduct a comprehensive code review to identify inefficiencies, bugs, and areas for improvement in the .net Core 6 code. - Improve software architecture to ensure scalability, maintainability, and performance of the application. - Implement robust measures to enhance the database security, in line with industry best practices. Ideal Skills and Experience: - Extensive experience in .net Core 6 and Entity Framework. - Proven track record of conducting code reviews and optimizing codebases. - Expertise in software architecture design and implementation. - ...
I'm looking for an experienced Shopify developer who can help me set up an e-commerce store for my physical goods. Key Requirements: - **Shopify Account**: I currently ...experience with handling a large amount of products on Shopify. I plan to start with over 200 products. - **Design & Functionality**: I need the store to be visually appealing and easy to navigate for users. Skills & Experience: - **Shopify Expertise**: Proven experience in setting up and customizing Shopify stores. - **E-commerce Proficiency**: Understanding of e-commerce best practices and how to optimize for conversions. - **Large Inventory Management**: Experience with handling a website with over 200 products. If you're confident in your ability to deliver a high-quality e-c...
I am seeking a talented website designer to cr...website will be the product catalog, so it needs to be well-structured and easy to browse. - The site should have a clean and professional design that not only showcases the products but also reflects the brand image. - As I have an existing inventory system, I would like the products to be integrated seamlessly into the website. Ideal skills and experience: - Proven experience in designing and developing e-commerce websites, particularly with a strong focus on product catalog design. - Knowledge of inventory management systems and experience in integrating them with websites. - Excellent graphic design skills to create a visually appealing interface. - Ability to understand and translate the brand's message...
I'm in need of a skilled professional to create a No-Code app on the Adilo platform or any other. It shall has three interface. 1. User Interface 2. Management Interface 3. Service Provider Interface App Idea: Chat based profile matching for Carpenters to work on hourly basis. User Interface Step 01 Signup Form with Phone, Email, Address Step 02 A chat box would open up with basic questions as; • Date for Booking • Time Period for Booking Step 03; Within the chat box the next question would be regarding the work profile Users can text to match profiles. Example: I want Bamboo Artisans Step 04: The Chat box will show all profiles for Bamboo Artisans as in the Directory or excel file Excel would be as simple as Skill Set, Profesional Prof...
I have purchased a VPS from hostinger. Now, It supports Linux. I am looking for a proficient Linux expert who can assist me with installing software packages on my VPS. I want to install PhpMyAdmin, MySQL, Laravel, Email Server, DB Performance Tools and Server Performance Tools, React, others. Key requirements: - Proficient in Linux system administration - Experienced in VPS management - Capable of installing software packages effectively Project will be considered as complete only once it is working fine. You need to perform it on our machine as we will share our screen with you as we need to document all steps. Kindly mention your bid and time required while biding. Also, mention which Linux Version is preferable as per your expereince.
I need Subscr...decision to your expert judgement. I am looking for a freelancer with experience in WordPress, Elementor and responsive design, as well as a keen eye for detail to ensure the website is a true representation of my Figma design. Website is subscription based so you should have good experience to WordPress to develop subscription based website where user can pay for subscription we are offering. Please send me any subscription based website where I can see user login/signup and there subscription account management so that they may change OR cancel there subscription. I will only consider those proposals who will provide there elementor based website demonstration as well as subscription based. I have already design in figma so figma expertise is also ...
...Tasks: - Customize website templates in line with our brand image. - Create dynamic web pages that offer a smooth and interactive user experience. Content Addition: - The revamped website will include an array of content types for the most meaningful interaction. This includes blog articles for knowledge sharing, product listings for sales purposes, a portfolio showcase to display our achievements, and Learner Management System (LMS) integration for imparting e-learning. Ideal Skills: - Proficiency in - Experience working with dynamic web pages - Expertise in customizing templates - Familiarity with blog incorporation, product listings, portfolio, and LMS integration With these specific skills and experience, I am certain of engaging in a ...
I need a PHP site that includes a straightforward yet robust admin panel. To fit my specific needs, it should have: 1. All Page Dynamics 2. App Listing with article edit...20. Sitemap Automatically Generated+ Frequently Daily Change I haven't chosen a design motif yet, so ideally, you're able to suggest and create designs that are user-friendly, attractive, and compatible with the features. In addition, no specific external integrations, such as payment gateways or social media platforms, are needed at this moment. Ideal candidates will have a proven track record in PHP development, with a portfolio demonstrating their skills in designing user-friendly admin panels and a strong understanding of user and content management. Proficiency in inte...
I'm in need of an Expert Excel programmer to help design a user-friendly Excel sheet focusing on stock and ledger management. Specifically, I'm interested in: - Incorporating Automatic Calculations: The ideal candidate should be able to create a system that automates complex calculations based on data inputs. - Dropdown menus: The sheet should offer an easy interface with dropdown menu options for hassle-free data inputs and editing. - Linking Stock and Sales: The sheet should be designed in such a way where the inventory updates automatically from sales data. So, a keen understanding of Excel's data integration and interconnection capabilities is necessary. - Essential Data Fields: My Excel sheet needs to include specific data fields like...
...integration of ISO standards in three of our company's subsidiaries: Subsidiary A, Subsidiary B, and Subsidiary C. Key Requirements: - Improvement of Quality Control: One of our primary goals is to enhance and standardize quality control processes across the subsidiaries. - Regulatory Compliance: Ensuring that our operations comply with relevant regulations is a crucial aspect of this project. Specific ISO Standards: - ISO 9001: Quality Management: This standard should be effectively implemented to enhance our quality control processes. - ISO 14001: Environmental Management: While not explicitly mentioned in the objectives, you should also consider the environmental impact in your work. - ISO 45000: This should be integrated to ensure tha...
I am in need of a Python developer to create a bespoke frontend for a warehouse management system. The system should primarily focus on Inventory management and Warehouse overview. Essential Functionalities: - Inventory Management: The system should allow for the easy management of inventory. - Warehouse Overview: An overview of warehouse status and stock levels should be clearly available. User Interface Design: - List View: I envision the inventory management interface as a list view with search and filter options for easy access and manipulation of data. Ideal Skills and Experience: - Proven experience in Python frontend development - Strong understanding and experience in Inventory management systems...
...displays, tracking of financial performance, and the ability to manage financial transactions. Basically the job is to either maintain existing front end code and/or make a website from scratch. Make one page of a website at $2/page (negotiable max $5/page) each, there may be in total 10-30 pages. Here's an example $3/hr for maintenance work (long term work). Interview questions : Please tell us more about your working and some success experience ? Please tell me some of your experience in reading someone else's code and then start working on it, How do you feel about that? What did you achieved? Do you agree with the budget and job description ? Please tell me what is your daily activities, are you a full time freelancer or do you have a full time job ? Wi...
I am in need of a proficient blockchain developer to create a Proof Of Stake system aimed at increasing transaction security. Integrating this system with Cosmos SDK is a key component of the project. The system requires the functionalities of staking rewards, a governance mechanism and slashing conditions. The ideal freelancer should have vast knowledge and experience with Cosmos SDK and the understanding of Proof Of Stake consensus rules. Proficiency in Golang or Rust is also a plus. These skills will facilitate the creation of a POS system that increases transaction security and offers differentiating features.
I'm in need of a dedicated professional to design and create a resource management application within MS Teams. This tool will be primarily used by team members. Key Features: - Task Tracking: The application should enable team members to assign and track tasks. - Resource Allocation: The tool should have a system in place that allows the allocation of resources. - Reporting: It should also offer a reporting feature to track the progress of tasks and resources. User Interface: - Simple and Minimalistic: I envision the user interface to be clean, uncomplicated yet efficient for managing tasks and resources. Ideal Skills: - Proficiency in MS Teams and its development capabilities - Experience in creating resource management applicatio...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
I am in need of a robust and efficient inventory management system made in Excel. This project requires: - Tracking of product quantities and managing stock levels to ensure seamless operation - Cataloguing of each product's relevant information including its name, SKU/Part number, quantity, batch number and expiry date - Methods of updating system quantities should be manual entry and bar code scanning. Knowledge in these methods is required. Ideal candidates should have extensive experience in Excel and inventory management system creation, preferably with a sound understanding of retail or related sectors. They should also be adept at implementing bar code scanning into Excel systems. Sharp attention to detai...
...network in real time, ensuring interactive connectivity. - Private Messaging: Ensuring secure conversations between users. - Profile Customization: Allowing users to modify their profiles reflecting different characteristics and interests. - Request Management: Facilitators for creating, sending, receiving, and responding to requests for activities to ensure accurate matches and dynamic user interaction. The ideal developers should have comprehensive knowledge and proven experience in native languages for either or both platforms. Experience in developing interactive social networking applications is a must. Demonstrated ability to integrate robust functional features into the app will be highly viewed. Expertise in ensuring user privacy in pr...
...one is to provide stringent and robust user management services, incorporating elements like user authentication, access control, and profile management. Key responsibilities will include: - Development of the entire API using Java and Springboot. - Establish secure user authentication processes. - Implement precise access control mechanisms. - Create and manage user profiles, ensuring systematic profile handling. Ideal Candidate: - Strong experience with Java/Springboot for API development. - Proficient in implementing user management functionalities. - Familiar with current best practices and standards in API design. - Excellent troubleshooting skills, with an ability to swiftly identify and rectify issues. In...
...Responsibilities: - Develop new features, modify existing functionality, and upgrade current modules for our web application using Codeigniter 4 framework. - Integrate a barcode scaning platform for scanning employee bagdes to store check-in and check-out periods to track attendance and overtime of employees. - Collaborate with our team to understand requirements and implement solutions effectively. - Write clean, well-documented, and maintainable code. Requirements: - Has extensive experience in PHP frontend and backend development. - Experience in database management. - Extensive experience with CodeIgniter 4 framework. - Experience with front-end technologies such as HTML5, CSS3, JavaScript, and jQuery. - Excellent communication skills and attention to de...
I'm looking for a diligent freelancer to help me with a straightforward data entry task. The task involves: - Collecting text data from various websites - Organizing and inputting the data into Word documents. The ideal candidate should be: - Skilled at conducting online research - Proficient in Microsoft Word - Detail-oriented and able to maintain accuracy - Good at time management to ensure timely completion of the task. Your role will be pivotal in creating a structured, comprehensive database from the web content I provide.
I'm in need of an experienced Shopify developer to help me create a highly professional and corporate-looking e-commerce store. Please apply with reference links Key Tasks: - **Product Catalog Management**: The store will require bulk product uploads and inventory tracking. Efficient management and organization of products is crucial. - **Payment Gateway Integration**: Aspects of this job include setting up secure and seamless payment options for customers, ensuring their transactions are secure. - **Theme Customization**: The store should exude professionalism and corporate appeal. The ideal candidate will be sensitive to the need for a clean, minimalist design. The ideal freelancer for this project: - Proficient in Shopify store creation and ...
