Perl vb net translator punët
Mua me pelqej qe te perkthej ne disa gjub te ndryshme dhe te firoj para
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I need someone to translate my CV from French to English. It's not just a regular translation job, I'd like something a little more creative. Here's what I'm looking for: - You should have a good grasp of both French and English, so you're able to translate effectively. - I don't want ...for: - You should have a good grasp of both French and English, so you're able to translate effectively. - I don't want a word-for-word translation. Instead, the translation should convey the same ideas and impressions, but with some degree of creativity. - Experience with CV or resume translation would be beneficial. - Knowledge of industry-specific terminology could also prove valuable. A translator who can make my CV not just understood but also engaging...
I have a set of legal documents in English that need to be professionally translated into Spanish. This is a project that requires an individual with the following skills and experience: - Native-level fluency in both English and Spanish. - Previous experience in translating legal documents. - Understanding of legal terminology in both languages. - Attention to detail and a high level of professionalism. The translated documents should be able to be used by legal professionals and should maintain the accuracy and intent of the original text. Please provide examples of previous translation work when bidding.
...my users' dashboard to the latest Angular version. The primary focus of this project is to optimize the dashboard's performance through responsive design. Key requirements: - Need to complete user dashboard UI from .NET API to the latest Angular version - Implement a responsive design to enhance load speed and overall performance - Prioritize optimizing charts and data visualization for a better user experience This project will require strong expertise in Angular, particularly in developing responsive designs. The ideal candidate should also have experience working with .NET APIs and be able to effectively optimize data visualization for improved performance. If you have a solid background in these areas and can deliver a high-quality, responsive user dashbo...
looking for an expert in video analytics to help with a live stream volume calculation project for inventory management. Key Requirements: - Utilizing video analytics to calculate and track volume - Developing a system to process live streaming video feeds - Find volume of a dirt pile using multiple fixed cameras and any other needed sensors in .NET core C#. Examples of apps already built - URC Ventures Stockpile Reports Lite iPhone app; ; Use openly available camera appliances so we shall be independent of any specialty vendors. Please provide testing procedures and testing tools in simulated conditions. If some 3rd party tools are used, our pre-approval, source codes and unlimited licenses be included, meeting
I'm seeking a skilled C# .net developer to improve the performance of my application. - Scope: The project involves fine-tuning the existing codebase, optimizing database queries, and enhancing the overall performance of the application. - Skills: The ideal candidate should have a profound understanding of C# .net development, experience in performance optimization, and a strong grasp of database management. If you're proficient in identifying bottlenecks and implementing solutions to boost system speed and efficiency, I'd like to hear from you. Please share your past relevant experience.
I'm looking for a proficient ASP .NET MVC developer who can help me create a web application with a specific focus on music streaming. Key functionalities of the project include: * Building the web application from scratch with ASP .NET MVC * Synthesizing a user registration system. It's essential to track user activity for future features, but no user login will be required to access content. * Establishing a data analytics feature. This data should be accessible to admins and will be used to gauge user preferences and activity. * Incorporating real-time notifications. This functionality should alert users of new content, primarily new music uploads. An essential part of this project is the local storage and streaming of music files. These files need to be store...
I am in need of a translator who can help me convert English legal documents into Spanish. Your role will be vital in ensuring the accurate and clear translation between these two languages, and in maintaining the original meaning and context of the content. Key responsibilities: - Translate English legal documents into Spanish accurately, without altering the original meaning - Understand and apply correct legal terminology in the translated text Skills and experience: - Proven experience in translating legal documents from English to Spanish - Proficient in both English and Spanish - Familiarity with legal terminology in both languages - Strong attention to detail and accuracy - Excellent communication and comprehension skills Please provide examples of previous translation wor...
I need to urgently translate my daughter's Bonafied Certificate from Russian to English. The translation needs to be done within 4 hours. Key Requirements: - Translate a Bonafied Certificate document from Russian to English. - Maintain the original formatting of the document. Ideal Attributes: -Looking for certified translator - Fluent in both Russian and English. - Prior experience in document translation. - Ability to work under tight deadlines.
I need an Italian translator to help with translation English to Italian
I'm in need of a skilled .Net developer with a strong background in C# programming. The project at hand involves the creation of a web application, specifically a content management system (CMS). Key requirements: - Proficiency in C# programming is essential - Strong grasp of the .Net framework - Experience in developing web applications using ASP.Net MVC - Prior experience with CMS development is highly preferred Your primary responsibility will be to develop a robust, efficient, and user-friendly CMS. This involves creating a system that allows for easy management and modification of digital content. If you have a proven track record in C# development, particularly within the context of web applications and CMS, then I'd be very interested in hearing from yo...
I'm looking for an experienced translator to adeptly translate a self-help book from English to Gujarati. The book is approximately 10,000 to 50,000 words long. Key responsibilities: - Accurately convert the nuances of the self-help genre in Gujarati. - Maintain the integrity and voice of the original text. - Deliver a high-quality translation free from grammatical mistakes. Ideal skills for the job: - Excellent written proficiency in English and Gujarati. - Knowledge and understanding of the self-help genre. - Proven experience in book translation. This project requires a balance of precision and creativity to achieve an engaging and faithful translation of the self-help book. Candidates should have a proven track record in Gujarati translation, particularly within the ...
I need a designer for a new Managed WordPress site, based upon my existing site All the content can be copied/pasted. I also need to keep that domain name for the new site. I will need minimum 10 pages, but expandable. Also a Google-style translator, Spanish and French.
I am in need of a skilled French Canadian translator to convert my short English story into French. The story doesn't contain any specialized terminology or jargon. Key points: - The translation must maintain the essence and tone of the original content. - It should be culturally relevant and appealing to a French Canadian audience. - Attention to detail is crucial to ensure a seamless and professional print publication. Ideal skills and experience: - Proven experience in translation, particularly for print publications. - Native-level fluency in French Canadian. - A good understanding of English and the ability to maintain the original content's essence and tone. - Experience in literary translation would be a bonus. If you meet these criteria and are confident in yo...
I'm seeking an experienced WordPress developer to craft an e-commerce website primarily using Easy Digital Downloads. Here's what I'm looking for: - Create an intuitive and seamless e-commerce experience. - Integrate Easy Digital Downloads as the core marketplace plugin. - Set up multiple Indian payment gateways, such as Net Banking, BHIM, GPay, and Phone Pay, ensuring security and ease of use. - Optimize site for performance, scalability, and SEO. Ideal Skills: - Proficiency in WordPress & Easy Digital Downloads - Experience with payment gateway integration - Strong portfolio with e-commerce examples - SEO and performance optimization expertise The successful freelancer will demonstrate a strong understanding of e-commerce strategies, particularly within the W...
...and do version control RESPONSIBILITIES: - Integration of new B2B APIs - New payment gateway integration - - Implementation of bug fixes and performance improvements. - Regular software updates and security patches. - Feature additions and enhancements. Skills and Experience: - Proven experience in maintaining e-commerce solutions. - Ability to work independently and meet deadlines. - .NET and are a plus but not a requirement. Prerequisites: For the long term project the *STARTING* wage will be as stated below. 1) Accept initial hourly rate of U$5.00 2) If awarded, accept and start work IMMEDIATELY 3) Have MINIMUM OF 20+ hours a week for long term ongoing support and development. 4) Work hours: predominantly 20:00 to 02:00 (UTC -3 Brazil TIME) 5) Be available to work on wee...
...that function on desktop- and mobile-friendly web pages • Interest in conducting research and learning new things to overcome challenges • Conducting website performance tests • Monitoring the performance of the live website • Experience optimizing web pages and improving page speed • Collaborate with internal teams to produce software design and architecture • Write clean, scalable code using NET programming languages • Test and deploy applications and systems • Revise, update, refactor and debug code • Improve existing software • Serve as an expert on applications and provide technical support • Designing and managing the website back-end including database and server integration • Generating WordPress themes...
I'm in need of a skilled English to Turkish translator who can help me with proofreading short, moderately complex sentences for a mobile app. Key Requirements: - Experience in translating to Turkish - Attention to detail; proofreading skills - Understanding of general audience's language level The project's goal is to ensure the content is accurately translated and retains its informational value for a general Turkish-speaking audience. Skills and Experience: - Proven experience in translation and proofreading - Familiarity with mobile app content is a plus - Strong understanding of the Turkish language and its nuances - Ability to keep the content accessible and engaging for the general public. Looking forward to your bids.
I'm in need of a professional translator with expertise in English to Turkish translation for a personal project. The task involves translating two personal letters from English to Standard Turkish. The tone of these letters is informal, so I need the translation to maintain this casual style. Key Requirements: - Proven experience in English to Turkish translation, particularly for personal correspondence - Fluency in both English and Turkish - Ability to maintain an informal tone in the translation I'm specifically looking for a translator with a good understanding of colloquialisms and the ability to ensure the translated message remains personal and engaging. Your experience in similar projects will be a big plus.
I'm in need of a professional translator who can translate legal documents from English to French. The translation is intended for submission to government agencies. 3 page work documents to be translated to french with word count of 900 words apporximate Ideal skills and experience for this job include: - Fluency in both English and French - Proven experience in translating the document - Understanding of the legal terminology in both languages Please note that I don't require the translation to be certified.
Write 'CHINESE' OR I BLOCK YOUR BID DEADLINE is 48 hours from accepted project. I need a skilled translator who is fluent in both Chinese symbols and Danish to help convert a medical journal. The journal's focus is on a specific medical field, and it requires a high level of accuracy. Key requirements: - Fluency in Chinese symbols and Danish - Translation experience in medical content - Attention to detail - Clear, concise language skills - Ability to meet a deadline Please provide your portfolio of previous translations, especially those in the medical field. The deadline for this project is definite, so I need someone who can meet it promptly. Thank you.
...of changes to my existing web application. The application is built on .NET, C#, MVC and MSSQL. The main areas of focus are: - **Database modification(If need)**: - **Adding New Features(If Need)**: I'm looking to integrate some new features into the web application as per requirement. - **Front-End Modifications**: I need some enhancements on the front-end, focusing on design/UI changes as per requirement. Additionally, the project would also involve: - **Back-End Modifications**: These would be required to ensure the new features are implemented effectively. - **Bug Fixes**: Any existing issues within the application should be identified and rectified. The ideal candidate should have extensive experience in .NET, C#, MVC and MSSQL. Additionally, they should ha...
...Proficiency in grammar, spelling, and punctuation - Knowledge and understanding of the subject matter - Ability to research and gather information - Attention to detail and accuracy - Experience in content writing and translation projects - Ability to meet deadlines and work efficiently - Strong communication and collaboration skills Project Description: I am looking for a skilled writer and translator to help me with a writing and translation project. The content needs to be in English and should have a length of more than 1000 words. The project requires someone with excellent command of the English language, strong writing and translation skills, and attention to detail. The ideal candidate should have experience in content writing and translation projects, with a proficien...
...Proficiency in grammar, spelling, and punctuation - Knowledge and understanding of the subject matter - Ability to research and gather information - Attention to detail and accuracy - Experience in content writing and translation projects - Ability to meet deadlines and work efficiently - Strong communication and collaboration skills Project Description: I am looking for a skilled writer and translator to help me with a writing and translation project. The content needs to be in English and should have a length of more than 1000 words. The project requires someone with excellent command of the English language, strong writing and translation skills, and attention to detail. The ideal candidate should have experience in content writing and translation projects, with a proficien...
I am having trouble with authentication issues in the .NET framework. Specifically, the login functionality is not executing as expected. Details: - The issue is particularly with the login failures. - The problem is not that users can't login despite their credentials being correct, but rather the login functionality not executing as expected. Ideal Skills and Experience: - A deep understanding of .NET Framework - Proven track record in resolving .NET authentication issues - Experience in troubleshooting and debugging login failures - Strong knowledge in .NET authentication processes.
I’m seeking a skilled developer to convert my existing PortVB Desktop App into an iOS/Mac Desktop App. It a small tool that runs on a Windows PC and reads some flat XML files and inserts/updates a mySQL database. We need the same program to be able run on a iOS/Mac desktop. I have all the VB Project files/ Source code. - Skills in app development for iOS/Mac, ideally with previous experience in app conversion - Knowledge of data syncing, user authentication, and offline access, in case these features need to be incorporated - Familiarity with contacts management, communication, scheduling, calendar integration, and file/document management functionalities for potential focus areas - Creative design skills to potentially revamp the user interface and overall design of t...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
SEI Membership Club, the leading international company, is home to exceptional high-net-worth individuals who are self-made, often billionaires, entrepreneurs, nobility, high-level professionals, and elite members. The company needs talented artists who are abstract and landscape watercolor and oil paint experts
Job Title: Full-Stack Developer for WordPress, .NET Middleware, Azure Integration, and SDK Development Job Overview: We are seeking an experienced Full-Stack Developer to spearhead the development and integration of key system components within our e-commerce platform. The successful candidate will lead initiatives to enhance user interactions by developing a WordPress plugin, building a robust .NET middleware API, and integrating advanced Azure-based messaging services. Additionally, the role involves creating an SDK to facilitate easy integration for third-party AI bot services. This position is crucial for ensuring that our platform not only meets current technological standards but also adapts to future advancements and user needs, enhancing both the scalability and func...
I'm looking for an expert who can put together a precise and comprehensive multifamily proforma that focuses on cash flow details. Specifics Required: - Include data on net operating income, debt service, and cash on cash return. - An in-depth monthly breakdown of these values. Skills & Experience: - Proven track record in financial analysis, specifically real estate and multifamily property market. - Professional approach with strong attention to detail. - High-level proficiency in using proforma software or Excel. - Understanding of the specifics of rental property cash flows.
need a reliable translator to work on a project that involves translating English content to Arabic. It's crucial that the translation captures both the cultural nuances and dialects of the target language. Key Requirements and Responsibilities: - Translate English text to Arabic, considering both cultural nuances and dialects. - Ensure that the translated content maintains the original meaning and tone. - Proofread the translation for accuracy and coherence. Ideal Skills and Experience: - Proven experience in English to Arabic translation, with a strong portfolio of work. - Familiarity with both English and Arabic cultural nuances and dialects. - Excellent linguistic and writing skills in both languages. - Attention to detail and commitment to quality. - Previous experience ...
I currently need an experienced online industrial designer who can help me perfect a textile net for my product designed for basketball practice. The main task will be to take the prototype of my existing product and make improvements so that the textile net pushes the balls towards the center of the court. What I want is not a video or a photo, I want computer checks and force studies to verify and test the reliability and probability of what happens when a ball passes through the inside of the funnel with the subsequent purpose of sending it to be manufactured. It will be necessary to provide measurements, material and verifications.
I urgently need an expert in C# to integrate my Point of Sale/Enterprise Resource Planning (POS/ERP) system with QuickBooks Online. The goal is seamless syncing of different modules, including, but not limited to: - Customer Information - Inventory Status - Purchase History - Sales Records - Products, Categories, etc... Familiarity with QuickBooks Online APIs and proficiency in C# .net Core is imperative for this role. Past experience with similar projects will be highly valued. The timeline is urgent; I need this integration done ASAP. we already have a code we made integration with SAP Business One, we can share this code to have the fastest development, and also we have the code of a previous developer who made of Quickbooks so it would help to see how to integrate
Description: We are seeking a talented web designer to enhance the design and user experience (UX) of our car audio dealers' e-commerce website. Our current platform h...Provide design deliverables using Figma or similar tools. Requirements: - Proven experience in web design and UX for e-commerce sites. - Proficiency with Figma or equivalent design software. - Ability to work within platform limitations to deliver a high-quality design. - Strong portfolio showcasing previous design projects. Additional Information: - You will collaborate closely with me (a .NET and React TS developer) to ensure seamless implementation of the design. - Clear and effective communication is crucial for this project. If you have a passion for web design and a keen eye for detail, we'd lo...
I have a dataset of images and I'm looking for someone experienced in U-Net algorithm. Project description: - Write PyTorch U-Net training model on top of provided base code (, , , ). - Train the model until achieving a validation dice score of min. 0.875. - Deliver source code and trained model until Wednesday 10 pm (Vietnam time zone).
We are urgently looking for a skilled data researcher who will research online UK based local planning authority databases for certain information sets. - Specific focus is needed on planning submissions and permissions that require BNG (biodiversity net gain credits)(the leads). The information is to be taken from Local Planning Authority official websites (publicly available information and no logins required). An in-depth knowledge of planning submissions and permissions and BNG is NOT needed. What is however required is accurate information to be taken from those websites and converted into a database for us. - This work can be done remotely and only requires a computer and access to the internet. - The geographical focus of the UK planning authorities we require information ...
I'm looking for an experienced Indonesian to English translator, specifically for legal documentation. The translated content must be certified by a sworn translator. Key Requirements: - Translate legal documents from Indonesian to English - Certification by a sworn translator Ideal skills and experience: - Proven experience in legal document translation - Sworn translator certification - Fluency in both Indonesian and English
I'm looking to develop an Android app using .NET MAUI that focuses on facial detection and tracking for attendance monitoring. Key Requirements: - **Facial Detection:** The app should be able to detect faces in real-time. - highlight detected face with rectangle shape - **Server Communication:** Once faces are detected, the app needs to send this information to a server automatically. - **Attendance Tracking:** The primary goal of the app is to leverage this face recognition technology for attendance tracking purposes.(but no need do any page for this now ) Ideal Skills: - Proficient in .NET and MAUI platform for Android development - Strong experience with facial detection and recognition technologies - Prior work on real-time server communication from mobile apps - ...
...project is to showcase innovation. Key Components: - Canvas app - Component library - Power Automate flows - Environment variables - Connection references Required Application Information: Freelancers interested in this project should provide a brief description of their relevant experience and knowledge. Ideal Skills and Experience: - Microsoft Power Platform and Dataverse Expertise - C# and .NET Development - Package Deployer Tool Proficiency - Power Apps CLI and Visual Studio Code - Experience with Dynamics 365 SDK - Previous experience in publishing PowerApps solutions on AppSource - Ability to work with canvas apps, component libraries, Power Automate flows, environment variables, and connection references - Strong problem-solving skills - Good understanding of the App...
I am currently in need of a highly experienced Japanese translator who can provide spoken language services during crucial business meetings. The ideal applicant for this project should be equipped with the following: - Expert level proficiency in both Japanese and Hindi/English languages. - Proven track record in translating spoken word for business or corporate settings. - Deep understanding of professional and cultural nuances in Japanese business contexts. Your responsibilities would include attending business meetings (in person or virtually), translating discussions as they unfold, and potentially engage in direct dialogues if clarification is needed. The end goal is to empower seamless communication between my team and our Japanese associates. Your expertise will be pivotal...
Armenian to English Translator Required for translation
I need a professional Hindi to English translator to convert educational content in the form of documentaries. The educational content is in Hindi and needs to be translated into English. Key requirements: - Translate documentaries from Hindi to English. Would prefer: - Professional experience in translation. - Experience with educational content is a plus.
Required a dot net developer. Speacialized in Microservices acrhitecture based solution. Dotnet Core, C#, SQL, Data transformation, API gateway, Auth based security.
I need a professional English to Turkish translator for a one-page document. This translation is intended for business use and should maintain a formal tone throughout. Key requirements and skills: - Proven experience in English to Turkish translation, especially for marketing purposes - Strong understanding of business language and communication - Ability to maintain a formal tone in the translated content
I am looking for an experienced .NET developer who has worked on both web and desktop applications. The ideal candidate should also have a strong background in algo trading and low latency applications. Key Requirements: - Experience with C# and Visual Studio for .NET development. - Previous work on both web and desktop applications. - Proven experience with algo trading. - Prior experience working in low latency applications - React JS work experience is added advantage Skills: - Worked with Websocket, REST APIs - React JS - Ability to understand code written by others and refactor. - Write clean, robust and performant code. Your role will involve: - Building and maintaining robust, high performance applications. - Using your knowledge of algo trading to implement and opt...
I am looking for a Cantonese-Spanish translator to accompany me on a daytime business trip to Guangzhou in June (06/28, 07/1-2-3). The trip will last less than a week and involves business negotiations. Ideal candidates should be: - Speaks Cantonese and Spanish fluently. - Strong in industry-specific terminology, particularly in business. - If possible, have some experience in exports. Your main responsibility will be to help me with translations during the different business meetings that are scheduled. Their role is crucial to ensure fluid communication. Your support will be greatly appreciated.
