Sample attendance system vb programming punët
...customers solving problems with deliveries, tracking parcels online (EestiPost, Omniva, DPD, TNT, FedEx, UPS, etc…) handling issues reported by clients with products delivered, managing issues in case of delays, making orders modification, invoice modification, address modification, managing communication about returns, disputes, refunds, etc… Quality assurance: performing quality inspection of the sample of the products manufactured in order to escalate with factories possible faults and quality fluctuations issues whilst following up with customers who have been affected by production issues. Online technical support and troubleshooting: supporting customers when payment error occur, issuing credit card refunds, spotting technical errors and mistakes on the ...
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
Sample ghkjkjgkjgkjhgjkgjkgkjgjggkgjkgjkggjggjkgjgjkgjkgjkgjkgjkgjkgjgjgjgjgjkgkgjkgjgkjkgjkjgjgjkgkjkj
sjdbsliafhi'oqwja'nc;abjsfpwquhfajdaop'ndowbf9[whd9qjdop'adnABJFP9fhjwqo]jFSO;ABFI[GFHW9QiAJDPN;ASbfdpUHF
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
nhjkmbjkgugyufyufykjkhiu kiuy7yubnbjhggggghutyurrtr lbhrffyyffdfhbjjhgyfgjkgggnjhjvdrtstghjgszzxfvhjjhgjhjjsrdfjpooouiuyui
nhjkmbjkgugyufyufykjkhiu kiuy7yubnbjhggggghutyurrtr lbhrffyyffdfhbjjhgyfgjkgggnjhjvdrtstghjgszzxfvhjjhgjhjjsrdfjpooouiuyui
I'm in need of an experienced VBA developer who can create custom macros for me, specifically to assist in automating tasks within Microsoft Excel. I'd like to streamline processes and increase efficiency within the software. Key requirements: - Proficient in VBA: You should be well-versed in VBA programming and have a proven track record of creating efficient and effective macros. - Microsoft Excel expertise: Experience in working extensively with Excel is a must. - Automation focus: The macros need to automate a variety of tasks, including data entry, report generation, and potentially formatting. While the complexity of the data manipulation needed isn't explicitly detailed, please be prepared to work on tasks ranging from basic calculations to more intermediate ...
I am seeking an experienced programmer to recode a C++ webview2 sample program to use win32 calls compatible with a Microfocus Visual COBOL environment. This transformation involves a focus on maintaining critical user interface functions presently coded within the C++ webview2 sample. Key aspects of the project: - Conversion to Microfocus Visual COBOL - Prioritization and preservation of User Interface functionality Ideal skills and experience: - Proficiency in C++ and Microfocus Visual COBOL - Experience with understanding, adapting, and recoding complex coding samples - Familiarity with using win32 calls - A strong background in UI integration and function transfers.
Our...requires enhanced communication capabilities with Data Management Systems specifically for real-time data synchronization. Key requirements: - Facilitate seamless, real-time data exchange between our laboratory management application and the Data Management Systems. - Ensure data integrity and reliability throughout the synchronization process. Ideal skills and experience: - Proficiency in the programming languages French is built with to ensure seamless integration with the existing application. - Proven experience in developing real-time data synchronization mechanisms. - Strong understanding of data management systems to facilitate efficient communication and synchronization. - Ability to ensure the security, integrity, and reliability of the data exchanged during synchr...
We need an Illustrator to overwork and redo an existing design of a package for a pizzacarton. The artwork of the original is " sunken in the nirwana" so we have to redo it. Result we need an unscreened template. The sample is NOT the template we need - but very similar. The template will be supplied after we arranged the job in full. we need an appropriate template
...simultaneously sent to GoHighLevel (GHL) CRM for automated text and phone call follow-ups, as well as to an Excel sheet for manual review and further action. Key requirements: - Pixel Integration: Develop and implement a pixel solution that captures lead data. - Real-Time Collection: Ensure the system collects data instantly when a lead lands on the specified page. - GoHighLevel (GHL) Integration: Connect the system to GHL for automated text and phone call follow-ups. - Excel Integration: Enable the system to send collected lead data to an Excel sheet via email. Ideal skills and experience: - Proficiency in WordPress and pixel integration. - Experience with CRM systems, particularly GoHighLevel (GHL). - Knowledge of data handling and Excel automation. - Strong com...
...function on desktop- and mobile-friendly web pages • Interest in conducting research and learning new things to overcome challenges • Conducting website performance tests • Monitoring the performance of the live website • Experience optimizing web pages and improving page speed • Collaborate with internal teams to produce software design and architecture • Write clean, scalable code using NET programming languages • Test and deploy applications and systems • Revise, update, refactor and debug code • Improve existing software • Serve as an expert on applications and provide technical support • Designing and managing the website back-end including database and server integration • Generating WordPress themes and ...
Position: YouTube SEO Keyword Editor (Full-time) Location: Work From Home, Vativa Design & Development We're seeking a dynamic individual to fill the role of YouTube Content Sr. Executive at Vativa Design & Development in Chennai. This position is ideal for someone passionate about crafting engaging content, manag...to reach 10k viewers per week Requirements: - Bachelor's degree in any discipline. - Demonstrated proficiency in video editing software like Vizard, Adobe Premiere Pro or Final Cut Pro. - Thorough understanding of YouTube and social media platforms, including current trends and best practices. - Familiarity with social media SEO and adeptness in keyword optimization techniques. Please send the sample while applying for this post. *** Only looking fo...
I urgently need a Python script created to scrape data from Website 1 and write it to a CSV file. The data I need to extract is specific to TVL daily total. Site: Key Re...urgently need a Python script created to scrape data from Website 1 and write it to a CSV file. The data I need to extract is specific to TVL daily total. Site: Key Requirements: - Develop a Python script for web scraping - Extract TVL daily total data from - Save the data into a CSV file Ideal Skills: - Proficient in Python programming - Experience with web scraping tools and techniques - Strong understanding of data handling, especially writing to CSV files - Good communication for timely updates on the project's progress.
I am seeking a proficient and reliable safety advisor for a substantial lineup of Music Concerts, Sporting Events, BLVDs, malls etc. Ideally, you will have a strong level of experience and skills in managing safety issues at large scale events with an expected attendance of more than 5,000. Key Responsibilities: - Develop and implement robust safety measures addressing key anticipated issues including Crowd Control, Medical Emergencies, and Fire Hazards. - Review and approve all safety arrangements and plans prior, during and after the event, - Continuously monitor safety compliance during the event. - Quality control - Auditing and monitoring - Document management - Policy and procedures implementation - Other events safety related matters Skills and Experience Required: ...
I am looking for a Flutter developer with experience in working with sockets to help me for application. Ideal Skills and Experience: - Proven experience in developing Flutter applications - Extensive experience with socket programming - Previous work on real-time chat applications preferred Please note, I am only looking for individual developers, no companies.
I'm in need of a web-based multi SKU inventory software that primarily focuses on real-time inventory tracking. This software will be utilized by our warehouse staff to ensure products are correctly logged and easily retrievable. Key Features: - Real-time Inventory Tracking: The primary function of the system is to keep a close eye on the stock levels. - User-Friendly Interface: The software should be intuitive and easy to use for our warehouse staff. Integration: The system should have the capability to integrate with our accounting software. This is essential for keeping our financial records accurate and up-to-date. Ideal Skills and Experience: - Proven experience in developing inventory management software. - Familiarity with real-time inventory tracking. - Abilit...
I am working on React JS with Javascript Development Project. I need someone to Supp...someone to Support me for this Project atleast 4 to 5 hours Per day. Project will Exist more than 2 years. I need support through Remotely(zoom). I am looking for Good Experienced(4+ years) Person as a Frontend Developer, Who can work on the tasks Quickly. I am looking for Long term relationship. After this Project Completed means, we will give immediately another support project. I will Give you the Sample Task on Cypress Test Cases for 30 mins, If you Completed ON TIME means we will give you the Project. Cypress Test Cases Immediately Required. Required Skills : React JS, HTML, CSS, Javascript, Cypress Test Cases(Mandatory), SQL Basics Language Speaking Person : English Note: I will pay on ho...
We're looking for a seasoned backend developer adept at working with the platform. Our project primarily involves rectifying some issues and implementing standout features. The scope of work includes: - Implementing a seamless payment processing system. - Addressing some undisclosed issues. - Incorporating a solid user authentication system. - Optimizing the platform's performance. Prospective freelancers should possess proven experience in backend development, with solid understanding of different programming languages. Practical exposure to database management or mobile app development would be a plus, but is not a mandatory requirement. Prior experience with platform is a necessity. A prompt turnaround time and structured approach to problem-solving w...
I'm seeking a knowledgeable Arduino and IoT expert to create a sophisticated system for collecting data on water flow. Key functionalities required: - Pulse input data collection, specifically for monitoring water flow. - Understanding of Deep Sleep Mode to save Battery. - Data handling capabilities to efficiently send this information straight to the cloud system. The ideal freelancer for this project must demonstrate vast experience with Arduino programming, IoT systems, and data management. Familiarity with cloud technologies will be a significant plus. Ability to create a robust system capable of handling potential fluctuations in water flow is necessary. The chosen developer will be tasked with not just simple data gathering, but also with transfer...
I'm in need of a comprehensive 15-page report on utilizing Parasoft or Klocwork for C/C++ programming. The report should cover the following: - **Installation and Setup**: A detailed guide on how to install and set up Parasoft and Klocwork for C/C++. - **Configuring Rules and Standards**: Explanation on how to effectively configure rules and adhere to coding standards within both software. - **Analyzing and Obtaining Results**: An insightful overview on how to analyze code and obtain results using Parasoft and Klocwork. - **Pros and Cons**: Pros and cons of using both tools and an unbiased comparison. Ideal candidate should have: - Profound experience with Parasoft or Klocwork - Strong knowledge of C/C++ - Exceptional technical writing skills The report must be well-organize...
I need to find a skilled web developer for building a promotional website specifically targeting potential customers. The website would be largely multimedia-centric with a focus on images and videos showcasing the various aspects of my business. Requirements: - Proven experience in creating dynamic, multimedia-heavy websites - Understanding of how to optim...best practice to target potential customers effectively. Remember, the primary goal of this website is business promotion, specifically with potential customers in focus. Thus, the aesthetics, design, and content of the website should all align perfectly with this objective. The quality of images and videos would be of paramount importance, so prior experience in handling such content is a must. Sample websites are Dantec an...
Expertise: Ability to create a website with a modern, clean design similar to Ntiva. The site must feature unique pictures and content specific to Tymor Technologies. 3D Logo and Animations: Proficiency in integrating 3D logos and dynamic animations. Communication Skills: Excellent communication skills with the ability to provide regular updates via WhatsApp. Timeline Commitment: Ability to deliver a sample home page within 1 day of the start date and complete the entire website within 2 weeks. Content Development: Capability to create and integrate 25+ content-rich pages. Hosting Knowledge: Familiarity with WordPress, which is already active for hosting on our domain. Professional Input: Ability to provide examples and ideas to enhance the website’s design and functiona...
...experience in the field. - The ideal candidate should be comfortable with training individuals at an intermediate level of expertise in Data Structures and Algorithms. - While there are no specific topics mentioned at this time, a comprehensive understanding of basic data structures (Arrays, Linked Lists, Trees), algorithms (Sorting, Searching), and possibly advanced concepts (Graphs, Dynamic Programming) would be beneficial. Ideal Skills and Experience: - 2+ years of experience in Data Structures and Algorithms training. - Proficiency in a wide range of DSA concepts, particularly at an intermediate level. - Strong communication and teaching skills, as you will be responsible for training individuals with varying levels of experience in the field. If you are confident in your a...
I am seeking an experienced Unifier consultant to streamline our project management system and provide strategic guidance on process optimization. Key Tasks: - Conduct a thorough process review and analysis to identify inefficiencies and areas for improvement. - Implement workflow optimization strategies that enhance project efficiency and reduce time-to-completion. - Integrate multiple systems to ensure seamless data flow and accurate project tracking. Challenges: - Inefficient communication between teams: The current system hampers cross-functional collaboration and slows down project progress. - Manual data entry and duplication: We're struggling with data accuracy issues due to manual entry and duplication. - Lack of automation: The absence of automation is a bot...
I'm in the market for an EDI professional to assist with the implementation of our EDI system. This freelancer should have a deep understanding of Electronic Data Interchange (EDI) along with ample experience in its implementation. Key tasks include: - Data Mapping: A core aspect of this project will be to ensure efficient data mapping across our EDI system. This requires a solid grasp of data structures, formats, and flow within EDI. - Partner Setup: You'll be involved in setting up our EDI partners, ensuring seamless communication and transactions between various entities. This project is focused on the implementation phase. Ideal candidates will have prior experience in the successful implementation of EDI systems. You should be adept at identifying and rectify...
...JavaScript code to enable audio file submissions within a Moodle 'ASSIGNMENT' that will be transcribed by the ChatGPT API. Key Responsibilities: - Write JavaScript code to facilitate audio file submissions. - Implement the integration of the ChatGPT API for audio transcription. - Ensure the transcript is displayed within the Moodle assignment. Key Requirements: - Proficiency in JavaScript programming. - Prior experience with Moodle, understanding of its architecture, including the ability to create Javascript for Moodle. - Familiarity with API integrations, preferably ChatGPT or similar. - Strong communication skills to ensure seamless collaboration and understanding of the deliverables. - Attention to detail and ability to ensure data security within the Moodle platf...
I'm currently seeking a proficient freelancer in Google Cloud Platform (GCP) who specializes ...Platform (GCP) who specializes in Infrastructure setup, Virtual Machine management, and Data storage and management. Key Tasks: -Setting up a secure and efficient GCP Infrastructure -Managing and optimizing Virtual Machines -Handling Data storage and management effectively The freelancer needs to have: -Sound knowledge and experience in GCP -The ability to implement advanced automation in GCP Programming Skills: -High-level proficiency in Python -Competency in Shell scripting is necessary This project is for those who are passionate about cloud technologies and eager to help initiate an advanced level of automation within my GCP environment. Please, only those with the relevan...
I am in need of a specialized iOS application designed to discreetly monitor a person's phone activity, which includes messages, apps, and call logs. This will aid in suspending any underlying suspicions of infidelity. - Requirements: Monitoring should be both real-time and also allow for data retrieval for later viewing. - Ideal Skills: App development, iOS programming, data retrieval, security-focused development. Please note: Respect for personal privacy and legal boundaries is paramount. The application should be developed keeping in mind the proper ethical considerations. A strong understanding of the privacy laws related to such software will be highly valuable.
I am looking for a proficient freelancer to undertake CV screening focused on technical skills. The ideal candidate will have: - The ability to verify competence in the domains of Programming, Network Management, and Data Analysis. - An excellent understanding of these areas to an intermediate level so you can correctly identify them in CVs. Your communication skills should be top-notch to allow smooth interaction. Also, your educational background in a technology-related field will be advantageous. Your role will be to screen through CVs and identify candidates that meet the required technical criteria to proceed to the next round of our hiring process. Your accuracy and precision would be greatly appreciated.
I'm currently in the process of setting up a new enterprise and I'm looking for a talented graphics designer to assist me in the creation of a logo and some additional graphics. Key Points: - The primary task will be the design of a logo and websi...interested in additional supporting graphics to complement the logo and establish a consistent brand identity. - The successful freelancer should have a strong portfolio of past work in logo and graphic design. Please include relevant samples in your application. - I have an idea of what I have in mind please see attached I am thinking it needs to have a boy and girl panda, I don' like the eyes in the sample files. The business is called Panda Game Zone I am excited to see your past work and hear your ideas. Looking for...
I'm looking for a Python expert who can help me preprocess and normalize a CSV dataset for a machine learning project. Key Responsibilities: - Loading the CSV dataset - Adjusting timestamps - Merging data from a single file - Normalizing the data using Min-Max scaling Ideal Skills and Experience: - Proficient in Python programming - Solid understanding of data preprocessing techniques - Experience with handling and merging large datasets - Familiarity with statistical analysis and machine learning modeling This project is crucial for setting a solid foundation for the subsequent machine learning analysis. The freelancer who takes on this role should be able to execute these tasks accurately and efficiently, with a strong eye for detail.
I'm looking for an experienced Hindi female voice over artist with a professional tone for my Youtube channel. - The voice over should be: - Clear, professional, and engaging - Appropriate for an adult audience - The project involves: - Narrating educational content - Adhering to the script provided Ideal skills and experience for this project include: - P...an adult audience - The project involves: - Narrating educational content - Adhering to the script provided Ideal skills and experience for this project include: - Proven experience in voice over work, ideally for educational content - Fluency in Hindi and understanding of professional tone and delivery - Ability to engage an adult audience through voice Please provide your portfolio or sample work for my...
I'm looking for a skilled developer to implement DTLS in C for secure communication within a tight deadline of two weeks. Key project requirements: - Implement DTLS in C: The primary goal of this project is to introduce DTLS to an existing system for secure communication. - Tight deadline: This project needs to be completed within two weeks. Timeliness and reliability are crucial. I need the data coming from the server to the client over UDP socket to be encrypted with DTLS, and it should appear as DTLS in the protocol section of Wireshark. In addition, the code should be able to handle streaming video or live feed over the socket accordingly. This code should work in linux and windows. Ideal Skills and Experience: - Proficiency in C: Extensive experience with C language i...
...showcasing our service quality, and attracting potential customers and build an engaging follower base. Key Responsibilities: - Develop a content (including themes for stories) calendar, considering a mix of vehicle showcases, before and after photos, and customer testimonials. The calendar should be designed for posts 2-3 times a week in a mix of reels and posts. The grid calendar should show a sample photos of what the post/reel cover should look like and a theme fot the post. The stories should be general ideas for daily stories (5 days per week) - Implement a balance between thematic content planning and random content. I am open to a mix of both approaches if you believe this will help improve our engagement. Skills and Experience: - Prior experience managing Instagram acc...
I need an experienced developer to create a custom online booking system for my business. The system should be integrated with our existing website and designed to handle online reservations. Key Requirements: - Develop a custom-built online reservation system to handle bookings for our services - Integrate the system with our existing website - Implement the necessary automation to streamline the booking process - Ensure user-friendly and efficient design for end users - Provide necessary documentation and support for future maintenance and updates - Connect the system to Ideal candidate: - Proficient in developing custom booking systems - Experience with integrating systems into existing websites - Strong understanding of automation and streamlining...
...any lag or delays. - Enhance Resolution and Texture Quality: I aim to make the game visually appealing by upgrading the resolution and texture quality. - Ensure Frame Rate Stability: It's crucial that the client maintains a stable frame rate throughout the gameplay. Ideal Skillset: - Proficiency in Java: Since the current client is based on Java, it's essential that you possess strong Java programming skills. - Experience with Game Development: A background in game development is highly preferred to understand the unique requirements of this project. - Graphics Optimization: Prior experience in optimizing graphics and performance will be a huge plus. The current RSPS client operates on Windows, hence the newly converted NXT client should be compatible with the same pl...
I'm a beginner wanting to learn how to create my first React Native app. I'm interested in building a simple multi-page app for both Android and iOS. Ideal candidates should have: - Proficiency in React Native and mobile app development - Prior experience in creating multi-page applications - Excellent communication skills to teach a programming novice like me
...able to: - Translate the spirit of my program into a visually appealing design - Understand the color scheme of red and yellow - Incorporate the elements of a bold S logo, circled by hands into the design. - view examples and use them for specific inspiration It's a youth program for kids ages 6-18 that combined education, outdoors, and leadership. I have provided the font sample and logo sample along with colors and help me design a logo. I have given 2 specific S examples only use those or small variances of those logos Must have hands around it to be considered Must use tagline "seek and you shall find under or around logo Only use the two S logos for design inspiration and do not variate to far. My main goal is to combine the elements w...
I'm a beginner in programming and am working on a personal project involving AI chatbots. I'm looking for a tutor to help me learn how to create them for a website. Key aspects of the project include: - Teaching me the foundational principles of AI chatbot design - Guiding me through the creation of a basic, functional AI chatbot for a website - Explaining how to integrate and maintain the chatbot on a website. I'm expecting the tutoring to be interactive and highly informative, you should be patient and good at explaining complex concepts in a simple manner. Experience in AI chatbot development, specifically for websites, is highly preferred. A solid understanding of programming concepts is also necessary, along with the ability to teach a beginner.
I'm in need of an experienced OCR Developer to build an OCR system that will be primarily used for document processing. The system should be able to process various types of documents including printed documents, handwritten notes, and scanned images. Key requirements for the project include: - Develop the system using Python, Java, and C# - Ensure that the system can accurately extract and process text from different types of documents - Implement a reliable method for processing printed documents, handwritten notes, and scanned images - Provide a user-friendly interface for uploading and retrieving documents Ideal candidates for this project should have: - Proven experience in developing OCR systems - Expertise in Python, Java, and C# - Strong understa...
I'm seeking a talented male voice-over artist to create a Chinese advertisement for my product. The voice-over should be warm and engaging, aiming to draw in the listener. Key Requirements: - Voice Tone: The ideal candidate should have a voice that is naturally friendly and inviting. Please avoid overly formal or energetic tones. - Gender: I am specifically looking for a male voice-over a...should have a voice that is naturally friendly and inviting. Please avoid overly formal or energetic tones. - Gender: I am specifically looking for a male voice-over artist for this particular project. - Experience: Prior experience in creating Chinese advertisements is highly preferred. Please provide a demo or samples of previous work in your proposal. - Duration: 1 Min Video. - Share your voic...
My project requires an expert in machine learning, particularly with a focus on using Python for neural networks. Ideal Skills and Experience: - Proven experience in machine learning projects - Expertise in Python programming - Proficiency in neural network programming - Strong understanding of deep learning Your understanding of machine learning principles, advanced Python programming, and neural network frameworks will be pivotal to the success of this project. Please detail your relevant experience and provide examples of similar projects.
...objectives include: - Programming the pi zero to accurately gauge low voltage conditions - Enabling the generator to automatically power up in case of a drop in voltage. - Continuing the generator input even after the voltage returns to normal, with this feature designed to maintain a steady and reliable power supply. Ideal Freelancer Skills: - In-depth understanding of Raspberry Pi Zero programming for hardware operations - Knowledge in direct physical connections in electronic devices - Impressive background in programming efficient and reliable automatic remote start systems - Understands voltage regulation and power backup systems - Experience in robust and fault-tolerant system creation is a plus. Your role will be instrumental in creating a reliabl...
If you are familiar with AWS programming, this should be a simple task for you. I have included an example C# solution using AWS Transcribe that I need to be working. Example Program: AWS Transcribe documentation: Requirements: • I will create a new AWS free account and will supply credentials. • In my AWS account, configure any IAM role/policy/user/credentials needed to run the example program. • Change the example program to accept credentials (accessKey/secretKey) as arguments passed to the executable. • Ensure that the corrected code successfully converts the speech in the audio file to text using the AWS Transcribe service. Deliverables: • All source code • Instructions
I'm in need of a skilled developer who can integrate Stripe payment into our current CRM system, which has an open API. The main function of the integration will be to track payments. Key Responsibilities: - Integrate Stripe payment system into our CRM - Ensure seamless payment tracking functionality - Testing the integration to ensure it's functioning correctly - Provide documentation on how to use the integration Ideal Skills and Experience: - Proficient in using Stripe APIs - Experienced in integrating payment systems into existing systems - Familiar with CRM systems and how they interact with external APIs - Strong problem-solving skills and attention to detail If you possess these skills and have prior experience in similar projects, I'd love to hear fr...
We are seeking an experienced Shopify developer to create a custom tracking system for our Shopify store. This system will manage and update the status of our workflow and must be capable of sending notifications via email or text. Additionally, we are looking to integrate this system with Klaviyo for enhanced notification capabilities. Key Features Needed: Status Tracking: Ability to update and track the following statuses: Checked in in Queue Work In-Progress Waiting on Customer Waiting for Parts Complete Ready for Pick-up Notifications: Send automated notifications via email or text. Potential integration with Klaviyo for advanced notification options. Requirements: Proven experience in developing Shopify applications or integrations. Strong understanding of Sh...