Sample vb net codehiring school system punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
...customers solving problems with deliveries, tracking parcels online (EestiPost, Omniva, DPD, TNT, FedEx, UPS, etc…) handling issues reported by clients with products delivered, managing issues in case of delays, making orders modification, invoice modification, address modification, managing communication about returns, disputes, refunds, etc… Quality assurance: performing quality inspection of the sample of the products manufactured in order to escalate with factories possible faults and quality fluctuations issues whilst following up with customers who have been affected by production issues. Online technical support and troubleshooting: supporting customers when payment error occur, issuing credit card refunds, spotting technical errors and mistakes on the ...
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
Sample ghkjkjgkjgkjhgjkgjkgkjgjggkgjkgjkggjggjkgjgjkgjkgjkgjkgjkgjkgjgjgjgjgjkgkgjkgjgkjkgjkjgjgjkgkjkj
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
nhjkmbjkgugyufyufykjkhiu kiuy7yubnbjhggggghutyurrtr lbhrffyyffdfhbjjhgyfgjkgggnjhjvdrtstghjgszzxfvhjjhgjhjjsrdfjpooouiuyui
nhjkmbjkgugyufyufykjkhiu kiuy7yubnbjhggggghutyurrtr lbhrffyyffdfhbjjhgyfgjkgggnjhjvdrtstghjgszzxfvhjjhgjhjjsrdfjpooouiuyui
Need a site like :// USER ID : admin PASS : admin
Looking for short-form editors to create TikTok videos: - Videos will be at least 1 minute long - Covering various niches - paid per video at first then moving to a monthly structure looking for a long-term partnership sample of work being created: @info_nity360/video/7332197214682402090 @dontsaythesame_/video/7346995607149612321 @granderquiz/video/7351415372559502625?lang=en will start immediately once hired send samples of work thank you
...my users' dashboard to the latest Angular version. The primary focus of this project is to optimize the dashboard's performance through responsive design. Key requirements: - Need to complete user dashboard UI from .NET API to the latest Angular version - Implement a responsive design to enhance load speed and overall performance - Prioritize optimizing charts and data visualization for a better user experience This project will require strong expertise in Angular, particularly in developing responsive designs. The ideal candidate should also have experience working with .NET APIs and be able to effectively optimize data visualization for improved performance. If you have a solid background in these areas and can deliver a high-quality, responsive user dashbo...
I'm looking for a proficient mechanical engineer to design a geothermal snow and ice melt system in my driveway. There is no existing heating system to integrate it with. The driveway is quite extensive, at a little over 3300 square feet. Ideal skills and experience for the job: - Understanding of depths and number of wells needed for the system. - The heat exchange system and heat pump required to handle this square footage - Prior experience setting up geothermal systems - Knowledge or experience in dealing with large-scale driveway installations - Ability to work without integrating existing heating systems.
...various social media platforms can be beneficial. I’m looking for freelancers who are able to work quickly, maintain a high level of accuracy, and who have some experience with data entry, website management, and social media. The work is urgent and will require dedication. Please bid only if you are an experienced freelancer who can commit to a large volume of work. There will be a small sample task to complete prior awarding....
looking for an expert in video analytics to help with a live stream volume calculation project for inventory management. Key Requirements: - Utilizing video analytics to calculate and track volume - Developing a system to process live streaming video feeds - Find volume of a dirt pile using multiple fixed cameras and any other needed sensors in .NET core C#. Examples of apps already built - URC Ventures Stockpile Reports Lite iPhone app; ; Use openly available camera appliances so we shall be independent of any specialty vendors. Please provide testing procedures and testing tools in simulated conditions. If some 3rd party tools are used, our pre-approval, source codes and unlimited licenses be included, meeting
I'm seeking a skilled C# .net developer to improve the performance of my application. - Scope: The project involves fine-tuning the existing codebase, optimizing database queries, and enhancing the overall performance of the application. - Skills: The ideal candidate should have a profound understanding of C# .net development, experience in performance optimization, and a strong grasp of database management. If you're proficient in identifying bottlenecks and implementing solutions to boost system speed and efficiency, I'd like to hear from you. Please share your past relevant experience.
...Golf Course Geographic Distribution of Customers Local Area Analysis: Breakdown of customers within a 10-mile radius. Analysis of nearby neighborhoods and communities. Heatmap visualization showing customer density. Regional Analysis: Breakdown of customers within a 50-mile radius. Analysis of major towns and cities contributing to the customer base. Heatmap visualization showing customer density. Sample Visualizations Heatmap of Customer Distribution: Shows areas with the highest concentration of customers. Bar Chart of Top 10 Cities/Towns: Displays the cities/towns with the most customers. Pie Chart of Customer Age Groups: Illustrates the distribution of customers by age group. Map of National Customer Reach: Highlights the states from which customers visit. I need a comprehen...
I need a freelance designer to help with the layout and design of soft toys aimed at school-age children. Tasks you'll be responsible for include: - Redesigning the layout of our existing soft toy line - Offer creative ideas for design improvement, keeping the target audience in mind Ideal candidates should possess a strong background in toy design and an understanding of what appeals to school-age children. Excellent artistic skills and an eye for details are essential. Familiarity with the soft toy manufacturing process would be a bonus.
I'm in need of an experienced Flutter Web App developer to develop a one page sample app that uses Firebase as back end. The app should be able to list Excel files from the server and allow the user to select a file and email the file as an attachment. The function must work on Android devices including Chromebook. The development environment must be on a MacBook with Android Studio IDE. Sending URLs instead of attachments is not acceptable. Key Requirements: - Utilize Flutter for the front-end development. - Incorporate Firebase for back-end data management. - Implement support for Excel files specifically. - Provide means to list the documents stored in the Firebase account. - Include functionality to email these files as an attachment. Ideal Skills: - Proficiency in Flutte...
I'm in search of an experienced video editor to assist in editing corporate and social media advertising videos. Requirements: - Edit a series of corporate videos and social media clips - The final output should be under 1 minute - A cinematic editing style is preferred - must need minimum 2 years of experience in editing...videos and social media clips - The final output should be under 1 minute - A cinematic editing style is preferred - must need minimum 2 years of experience in editing Ideal Skills and Experience: - Proven experience in editing corporate and social media videos - Strong capability to craft a story within a minute - Proficient in using editing software to achieve a cinematic effect - I must need a sample edited video I'll share more info after selecti...
...File System based on the Google File System (GFS) - a system we'd like to dub as miniGFS. This project seeks to achieve: - Efficient storage and access of large files: The miniGFS should handle large data quantities seamlessly, allowing both read and write operations swiftly. - Data replication and fault tolerance: This project prioritizes data integrity and availability, necessitating a system designed for data replication and recovery in the occurrence of a fault. - Parallel processing: Optimum speed during file operations can be achieved through parallel processing functionality and the miniGFS should capitalize on this. - Data distribution across multiple nodes: To ensure efficient space use and increase speed, data distribution across various ...
I'm seeking a talented male voice-over artist to create a Chinese advertisement for my product. The voice-over should be warm and engaging, aiming to draw in the listener. Key Requirements: - Voice Tone: The ideal candidate should have a voice that is naturally friendly and inviting. Please avoid overly formal or energetic tones. - Gender: I am specifically looking for a male voice-over a...should have a voice that is naturally friendly and inviting. Please avoid overly formal or energetic tones. - Gender: I am specifically looking for a male voice-over artist for this particular project. - Experience: Prior experience in creating Chinese advertisements is highly preferred. Please provide a demo or samples of previous work in your proposal. - Duration: 1 Min Video. - Share your voic...
I need a skilled freelancer to create a comprehensive lead generation and auto-boarding system using System.io. Key Responsibilities: - Developed using for B2B lead generation, with the primary goal of increasing lead generation - Implement effective email marketing strategies within the system - Incorporate conversion optimization tactics to maximize lead conversion Ideal Candidate: - Intermediate level expertise in using - Extensive experience in lead generation, ideally within a B2B context - Proven track record in successful email marketing campaigns - Strong understanding of conversion rate optimization The project will require a highly organized individual with a keen eye for detail and the ability to implement a strategic and data-driven approach to lead generati...
I need some one to clean a file that has names and addresses The field with the name has business names and first and last name combined. I need them separate. Also some time there are two name or a last name and then the first name of a husband and the first name of the wife I need all that in separate fields See attached sample
...website. The website should riff off a sample site which I will provide during our first conversation. Please note, I've already secured the domain and hosting. Your role will be to ensure that the site is ready for use. Key features should include: - Efficient Search Functionality: Users should be able to easily locate the tools they require. - User Registration and Login: This will help track user preferences and allow users to save their tools. - Integration of Google Adsense: Ads will be displayed on the site to generate revenue. The ideal candidate would have experience in developing corporate style websites with a keen eye for creating intuitive navigation for primarily professional users in a particular industry. Proficiency in user registration system develo...
I am in need of a skilled developer to create a robust EV charging system with a custom backend. Key Functionality: - User Management: I need a system that supports user authentication and management. This includes user registration, login, and profile management. - Real-time Updates: The system should provide real-time status updates on the charging stations. This is essential for user convenience and system monitoring. - Payment Integration: I want to integrate a payment processing system. This should support invoicing and be capable of handling different payment methods. - OCPI and OCPP Integration: The ability to work with these standard protocols is a must. Backend Specification: - Web Socket Support: The backend server must support web sockets to ...
I have a kitchen range hood in the restaurant, I need the hvac design including the exhaust and ventilation design of the range hood with the calculation, the range hood is of 16' Please submit your sample work alongside thanks
I'm looking for a proficient ASP .NET MVC developer who can help me create a web application with a specific focus on music streaming. Key functionalities of the project include: * Building the web application from scratch with ASP .NET MVC * Synthesizing a user registration system. It's essential to track user activity for future features, but no user login will be required to access content. * Establishing a data analytics feature. This data should be accessible to admins and will be used to gauge user preferences and activity. * Incorporating real-time notifications. This functionality should alert users of new content, primarily new music uploads. An essential part of this project is the local storage and streaming of music files. These files need to b...
I need help with developing an advanced passenger information system for a public transportation project. This will primarily involve creating a notification system to promptly alert riders of delays or any changes to their journey. Potential freelancers should ideally have: - An understanding of transport logistics - Experience with application or software development especially with geo-location and notification functionalities - Ability to design a system that is user-friendly and accessible to a large number of users Providing a robust, efficient system that users can depend on is the key.
I am looking for a creative and professional designer to create a logo that represents my local Ultimate Frisbee competitive sport business, Brighton Youth Ultimate. Key Requirements: - Incorporate our brand colour, which is #8AF3C8. - The logo should be suitable for a young audience but remain professional, as it will be used in school taster days, after school clubs, and weekly junior training sessions. The logo will be used on the website, printed on Ultimate Frisbee discs, and printed on kit for players. Please provide in formats: jpeg, png and AI.
I'm in need of a unified system that can handle automated quotes, product management, and delivery for my websites on both BigCommerce and WooCommerce. Key Features: - Real-time inventory management - Customizable product options - Shipping cost calculator Ideal qualifications: - Proficient in eCommerce platforms BigCommerce and WooCommerce - Experience in building automated systems - Skilled in integrating different platforms - Expertise in inventory management - Knowledge in shipping cost calculations I have websites on both BigCommerce and WooCommerce and I would like a seamless, unified system to manage these aspects for both. If you have the skills and experience to help me, I'd love to hear from you.
We will do only foundation with reinforcement as per sample we have will need $800 and 2 days.
...segmenting primary school level maths questions based on the specific skills required to answer them correctly. The task will be to review 50 past papers - containing approx 50 questions each. For each question, I need someone to: - cut & paste an image of the question into a Google slides / Powerpoint document - 1 question (or sub-question if it requires a different skill per page - 1 document for each paper - name the skill(s) that are required to answer each question - as the title for each page - create a new line in a Google Sheets / Excel document with the following information: - skill required (copied from title of Google Slides document) - page number of Google Slides document that the question appears on Key Requirements: - The questions are from pri...
... particularly focused on enhancing vocabulary, word choice, presentation, and public speaking skills. - Assist Middle School Students: My main focus is to provide comprehensive support to intermediate leveled middle school kids. They are in vital need of enhancing and enriching their vocabulary and improving their presentation skills. - Multifaceted Approach: I am looking for a versatile tutor who can provide help using a variety of methods. This should include online tutoring sessions, creating interactive video tutorials, and providing written feedback on their assignments. - Required Experience: Previous experience in teaching English language arts at middle school level would be a definite plus. Bulls-eye would be someone who is patient, understanding, and k...
I'm in need of a creative writer to come up with "Would You Rather" jokes for a middle school audience. The jokes should: - Be suitable for middle school students. - Be delivered in written form, without the need for illustrations or audio. - not IA generated - not from internet or from existing books (sorry, we already have them all) Ideal candidates for this project are: - Experienced writers or joke creators who understand the unique sense of humor of middle schoolers. - Able to produce engaging and fun content that is suitable for kids/family party. - Creative and able to come up with a wide range of jokes on different everyday topics. Your work will help entertain and engage our young listeners and must respect the target audience's age and sensi...
I'm in the market for an EDI professional to assist with the implementation of our EDI system. This freelancer should have a deep understanding of Electronic Data Interchange (EDI) along with ample experience in its implementation. Key tasks include: - Data Mapping: A core aspect of this project will be to ensure efficient data mapping across our EDI system. This requires a solid grasp of data structures, formats, and flow within EDI. - Partner Setup: You'll be involved in setting up our EDI partners, ensuring seamless communication and transactions between various entities. This project is focused on the implementation phase. Ideal candidates will have prior experience in the successful implementation of EDI systems. You should be adept at identifying and rectify...
I'm in need of a skilled .Net developer with a strong background in C# programming. The project at hand involves the creation of a web application, specifically a content management system (CMS). Key requirements: - Proficiency in C# programming is essential - Strong grasp of the .Net framework - Experience in developing web applications using ASP.Net MVC - Prior experience with CMS development is highly preferred Your primary responsibility will be to develop a robust, efficient, and user-friendly CMS. This involves creating a system that allows for easy management and modification of digital content. If you have a proven track record in C# development, particularly within the context of web applications and CMS, then I'd be very interested in h...
The purpose of this report is to propose the system analysis for the client, with the intention of ensuring all stakeholders involved agree to the planned solution. Throughout the project the analysis, development, implementation and testing phases will be conducted using the industry standard, agile development life cycle. This specifies that changes can be made if required and appropriate. The system analysis report is intended for all the project’s major stakeholders: the client, the trainers, the costumers ,if they can be involved, and the development team.
I am in need of a computer engineer who can assist me in developing a WhatsApp embedded onboard system. This system should be capable of sending, receiving, and managing messages. Key Requirements: - Implementation of WhatsApp integration for an onboard system. - Functions to send, receive, and manage messages through the onboard system. Preferred Skills: - Proficiency in C#. - Familiarity with Visual Studio MVC projects. - Experience in embedded systems and software development. - Familiarity with messaging application development. - Strong problem-solving abilities for hardware-related issues. Should you have a background in both computer engineering and software development, with a particular proficiency in C#, I'd like to hear from you. This is a uni...
...lot of time. Whoever wants to work can create the same product page on their own and bid. I'll talk then, otherwise not. I'm looking for a skilled WordPress developer : I only need one page. It must have a product that functions like this one: I need same website landing page but just to reiterate, the functions are more important than the look. From custom wording to a handcrafted cover, the Personalized High School Diploma for Homeschools is an official document to honor your grad! Homeschool Diploma The product must be customizable with text and adornments that the customer chooses. The most important part is that the customization choices will show on the picture in real time. In other words, the picture
I'm seeking an experienced AI specialists to develop AI mod...people with no hat, food is dropped, dropped food is put back on dishes to serve customers. Each AI model should provide an immediate visual notification, aiming for rapid response times. Additionally, the system should automatically notify the manager to ensure immediate action. For this project, proficiency in AI programming, particularly around object detection is key. Experience in designing systems for the hospitality sector would be a definite plus. Requirements: AI Engineers or AI scientists have at least 5 years experience in AI and at least 2 years experience in building AI system for CCTV cameras. Let send me your profile (CV, website, link to finished projects which is relevant to this projects). ...
Overview: This application will enable Shopify store owners to collect and display customer reviews. However, only customers who have made a purchase will be able to leave a review. You can use the reviews app that Shopify provides as a :// Project Requirements: User Authentication: • There should be no public option for writing a review on the store’s frontend. Review Collection: • After a purchase, customers should receive an invitation via email to write a review. Review Display: • Reviews submitted by customers should be displayed on the respective product page of the Shopify store. Webservice Integration: • All reviews must be sent to an external webservice for additional processing or storage. Subscription Plans: • The
I'm seeking an experienced WordPress developer to craft an e-commerce website primarily using Easy Digital Downloads. Here's what I'm looking for: - Create an intuitive and seamless e-commerce experience. - Integrate Easy Digital Downloads as the core marketplace plugin. - Set up multiple Indian payment gateways, such as Net Banking, BHIM, GPay, and Phone Pay, ensuring security and ease of use. - Optimize site for performance, scalability, and SEO. Ideal Skills: - Proficiency in WordPress & Easy Digital Downloads - Experience with payment gateway integration - Strong portfolio with e-commerce examples - SEO and performance optimization expertise The successful freelancer will demonstrate a strong understanding of e-commerce strategies, particularly within the W...
I'm looking for a talented graphic designer who can create top-notch infographics for product...graphic designer who can create top-notch infographics for product descriptions and feature explanations on Amazon. The infographics should capture the benefits of the product and provide instructions on how to use it effectively. Your responsibility will be: - To create clear, captivating infographics that give a neat portrayal of the product's advantages and usage. - Edit RAW photos as per sample provided that appeal notably to Amazon consumers. Ideal skills and experience: - Strong graphic design abilities - Photoshop Experience - Prior experience creating Amazon or eCommerce infographics - Understanding of consumer psychology, able to create designs that attract and reta...
...and do version control RESPONSIBILITIES: - Integration of new B2B APIs - New payment gateway integration - - Implementation of bug fixes and performance improvements. - Regular software updates and security patches. - Feature additions and enhancements. Skills and Experience: - Proven experience in maintaining e-commerce solutions. - Ability to work independently and meet deadlines. - .NET and are a plus but not a requirement. Prerequisites: For the long term project the *STARTING* wage will be as stated below. 1) Accept initial hourly rate of U$5.00 2) If awarded, accept and start work IMMEDIATELY 3) Have MINIMUM OF 20+ hours a week for long term ongoing support and development. 4) Work hours: predominantly 20:00 to 02:00 (UTC -3 Brazil TIME) 5) Be available to work on wee...
I am seeking a skilled and experienced designer who can help me with a simple yet crucial task:...rebranding process, helping us to align our products with the new brand identity. Ideal Skills: - Extensive experience with Photoshop, particularly with the Hue/Saturation tool - A good eye for aesthetic improvements - Experience with product image editing or e-commerce Deliverables: - All files should be high-resolution(similar to original photos) and in a format same as given image not same as sample color image. Please let me know if you're proficient with Photoshop and have experience with similar projects. I'm looking forward to seeing examples of your past work. Attached Zip file of images. It includes 12 colour variations and 2 products. It means, total 24 variatio...
I am seeking an experienced programmer to recode a C++ webview2 sample program to use win32 calls compatible with a Microfocus Visual COBOL environment. This transformation involves a focus on maintaining critical user interface functions presently coded within the C++ webview2 sample. Key aspects of the project: - Conversion to Microfocus Visual COBOL - Prioritization and preservation of User Interface functionality Ideal skills and experience: - Proficiency in C++ and Microfocus Visual COBOL - Experience with understanding, adapting, and recoding complex coding samples - Familiarity with using win32 calls - A strong background in UI integration and function transfers.
We need an Illustrator to overwork and redo an existing design of a package for a pizzacarton. The artwork of the original is " sunken in the nirwana" so we have to redo it. Result we need an unscreened template. The sample is NOT the template we need - but very similar. The template will be supplied after we arranged the job in full. we need an appropriate template
...simultaneously sent to GoHighLevel (GHL) CRM for automated text and phone call follow-ups, as well as to an Excel sheet for manual review and further action. Key requirements: - Pixel Integration: Develop and implement a pixel solution that captures lead data. - Real-Time Collection: Ensure the system collects data instantly when a lead lands on the specified page. - GoHighLevel (GHL) Integration: Connect the system to GHL for automated text and phone call follow-ups. - Excel Integration: Enable the system to send collected lead data to an Excel sheet via email. Ideal skills and experience: - Proficiency in WordPress and pixel integration. - Experience with CRM systems, particularly GoHighLevel (GHL). - Knowledge of data handling and Excel automation. - Strong com...
...that function on desktop- and mobile-friendly web pages • Interest in conducting research and learning new things to overcome challenges • Conducting website performance tests • Monitoring the performance of the live website • Experience optimizing web pages and improving page speed • Collaborate with internal teams to produce software design and architecture • Write clean, scalable code using NET programming languages • Test and deploy applications and systems • Revise, update, refactor and debug code • Improve existing software • Serve as an expert on applications and provide technical support • Designing and managing the website back-end including database and server integration • Generating WordPress themes...
Position: YouTube SEO Keyword Editor (Full-time) Location: Work From Home, Vativa Design & Development We're seeking a dynamic individual to fill the role of YouTube Content Sr. Executive at Vativa Design & Development in Chennai. This position is ideal for someone passionate about crafting engaging content, manag...to reach 10k viewers per week Requirements: - Bachelor's degree in any discipline. - Demonstrated proficiency in video editing software like Vizard, Adobe Premiere Pro or Final Cut Pro. - Thorough understanding of YouTube and social media platforms, including current trends and best practices. - Familiarity with social media SEO and adeptness in keyword optimization techniques. Please send the sample while applying for this post. *** Only looking fo...