Shop project vb punët
Behet fjale per nje online shop me disa tipare personalizuese, i cili do t'i sherbeje nje audience specifike. Implementimi i nje dizajni te sapoaprovuar eshte sfida e castit. Kerkohet nje zhvillues ne Tirane ne menyre qe te organizojme takime, diskutime prane zyrave tona.
Mё duhet njё uebsajt i ri. Projektoje dhe ndёrtoje Dyqan online Design shop website,
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
Potrebna mi je konfiguracija nasog OpenCart shopa za srpsko trziste. Porzes, mogucnosti placanja etc. Uz to treba i manji redesign i posle sajt optimizacija za google. Petreban je freelancer iz srbije / hrvatske za duzu saradnju. Nebi bilo ni problematicno da promenimo sistem (magento) I need help about my shop site - currenty Open Cart System - for the serbian market. The VAT and checout configuration hast ot be made, and some smaller backend tasks. Also I woul dlike to redesign some elements of the current theme - nothing special. And further I will need SEO (clothings). I am looking for a serbian / croatian freelancer to work with permanent.
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I'm looking for a skilled sewing machine mechanic who specializes in Durkopp Adler 558. The main task will involve making a video of routine maintenance...machines, ideally in a professional capacity. You MUST have access to a Durkopp Adler 558 in order for you to make the video. If you don't have access, please do not bid. I need a 30 minute video explaining how to use the machine, troubleshooting, fixing common problems, threading the machine, replacing basic parts, clearing jams. This video will be used to train staff using this machine at a sewing shop. So you must speak english, have a camera or good phone to video yourself explaining all the requirements above. One again, this is especifically for a Durkopp Adler 558, NOT for similar machines, or other model. It...
As the owner of a Magento 2 website, I am facing a set of challenges requiring urgent attention. Primary Issues: - Checkout process errors: Our sales are dropping and peo...errors: Our sales are dropping and people complained they can't pay. I found one solution: if we revert configurations from the backup that should be resolved. We sold last yesterday at 7 pm and there are no sales after that even though we can monitor customers who are going on the checkout page but aren't able to shop. This never occurred! Ideal Candidate: I am looking for a freelancer with extensive experience in Magento 2 who can accurately diagnose and resolve these issues. This project will be done through anydesk as we can't share access and please bid if you can fix these issues ...
I'm looking for someone skilled in finding trending electronics in China for my online shop. Key Requirements: - **Product Type**: Electronics - **Sales Channel**: Third-party platforms (e.g., Amazon, eBay) - **Key Focus**: Innovativeness Your role will be to source electronics that are both technologically innovative and in high demand. Your responsibilities will include: - **Product Research**: Identify trending electronic items in China that have a high potential for success in western markets. - **Supplier Qualification**: Evaluate and establish relationships with reliable Chinese suppliers. - **Cost Analysis**: Negotiate cost-effective deals without compromising on quality. The ideal candidate should: - Have a keen eye for spotting innovative products - Be experience...
I'm looking for an expert to help manage and promote my Etsy shop. Key Tasks: - I need to list products in my shop, particularly those within jewelry, home decor and art and craft supplies. - I currently have less than 50 listings on my shop, so there’s a scope for expanding the product range. - I am looking for a professional who can devise a sales-driven strategy to enhance visibility and attract potential buyers. -i want someone who can build google my business profile and manage the same. Ideal Skills and Experience: - Proficiency in Etsy shop & google my business management and promotion. - A track record of increasing sales for similar businesses. - Familiarity with jewellery, home decor, and art & craft supplies markets. Please ...
I am looking for an expert to manage and promote my Etsy shop, as well as open my google business shop. I have an inventory of handmade and unique items, and I need help with both platforms for better visibility and improved customer engagement. Your tasks would primarily include: - Inventory Management: Keeping track of existing inventory, update listing details if necessary and coordinate to replenish stock. Knowledge of Etsy’s listing system is necessary. - Promotion: Create and execute Social Media promotion strategies for both Etsy Shop and Google Business. You should have experience in leveraging different social media platforms for business promotion. Ideal candidate would have prior experience managing Etsy shops and Google Business listings, with pro...
v2 - user can find merchant and register in their user account. after admin approve, Merchant can create shop and promotion. User will get 0.1% of their total sales, check v3. - shop field (brand name, address, website, whtasapp, facebook, description, category, City, how many brands, open for agency?(radio button)) - promotion field (title, normal price, now selling price, description, expire date, point weight - V4 user can follow shop to see their promotion in feed, also can apply to be their agent. - agent can share the promotion with uniqic referral link which will earn 2% v3 - point system- user purpose any thing will get point same as the price, usd 23.12, will get 23.12 points. if point weight is 2, then he will get 46.24 point. - when userB purchase, user A ...
I'm in need of a Shopify expert who can assist me in customizing a theme. The task is expected to take no more than an hour. Key tasks include: - Theme Customization: Specifically, I require layout changes to the theme. This alteration is essential for the improvement of the online shop. - Online Work: The project will be carried out through , so you need to be comfortable working in that environment. Your Prior Experience: - A solid understanding of Shopify and its theme structuring is crucial. - Previous experience in theme customization will be a huge advantage. Please be ready to demonstrate your skills in this area. This job is fixed-price and the task is expected to be completed within an hour.
...calmness and serenity. Ideal Skills and Experience: - Proven experience in designing logos, especially for baby brands or similar consumer-focused industries. - Proficiency in modern, minimalistic design, with a good understanding of color psychology. - Experience in creating designs that are both playful and professional, suitable for a brand that caters to parents and babies. Brand Name : Chota Shop I am looking for a creative and professional logo design for my brand, "Chota". The brand "Chota" will encompass a range of products, each catering to different segments but unified under the same brand name. The logo should be versatile and adaptable to various products, including but not limited to Toys, Apparel Design Preferences: Simplicity: The logo s...
The brandname is CerminBro. Car windscreen repair and replacement. I'm in need of a professional and elegant logo that can be used across a variety of platforms - primarily online, in print and on merchandise. Key Project Requirements: - Design an elegant style logo - Ensure the logo is versatile for use across different mediums - Provide design files and source files for future editing Ideal Skills: - Proficiency in graphic design - Experience in creating versatile logos - Understanding of branding and logo use across different mediums Your creativity will be a great asset here, as the logo should be both eye-catching and adaptable. Looking forward to your proposals!
I'm looking for a creative mind to design a captivating logo for my juice shop, "Juice Riviera". Desired elements for inclusion are: - Colors: I'm keen on bright and vibrant hues to highlight our energetic and lively brand. Think reds, yellows, and oranges! - Symbolism: Incorporate imaginative interpretations of fruits like oranges, lemons, or berries and a glass or cup into the logo, demonstrating that we are a juice bar. Don't be constrained, let your creativity flow! The ideal freelancer should have: - Experience in graphic design, especially with food and beverage businesses - Portfolio showcasing usage of vibrant colors in previous projects - Strong communication skills to understand and bring my vision to life.
I'm looking to obtain contact information, specifically email addresses and physical addresses, of local jewellery shops from multiple countries. This information will be primarily used for a marketing campaign. The ideal freelancer for this job should possess: - Proficiency in web research and data collection - Proven experience in lead generation - Knowledge about the jewellery shop industry. I'm particularly interested in local artisans, as opposed to high-end luxury shops or exclusively online retailers. Please apply if you are confident in gathering accurate and quality data from various resources.
... The platform should be interactive and user-friendly, ensuring a smooth order submission process for our agents. Ideal Skills: - Proficient in PHP - Strong experience in web development - Knowledge in creating secure web forms - Experience in agent-based systems would be a plus Please bid for this project if you believe you have the skills and experience needed to deliver a high-quality, efficient, and secure PHP page for our agents. Our customer sells products (not online, but in shop). He wants to receive orders from agents. I have an excel file containing the products that he wants to sell. The excel file has 5 columns: 1st columns is for Brand 2nd column is for Model 3rd column is for Color 4th column is for Price 5th colums is for Quantity in Stock We want t...
I need a skilled drafter to create a detailed CMU wall reinforcing and grouting shop drawing based on an architectural drawing. Please find the specifics below: - The shop drawing needs to include Horizontal reinforcement, Vertical reinforcement, and Grouting details in 2 or 3 pages -Ideal candidates for this job should have prior experience in similar projects -I will send you architectural drawing. -I need this in 2 days
saya ingin mengirimkan project yang sudah saya buat
As we venture into the development of an online store for both Instagram and Facebook, we are looking to showcase our unique product - gift paper bags and gift packing wrappers. Key tasks include: 1. Developing an online shop for two social media platforms. 2. Creating engaging, sellable designs for our products. The ideal professional for this work should not only have experience in social media store development but should also be a credible product designer. They should understand up-to-date trends and be able to make design suggestions that will appeal to our consumers. Creativity, with a keen attention to details, and experience in design related to gift packaging is also a bonus.
I'm seeking a talented game-level designer to create a unique and engaging level for an FPS game set in a small Japanese town center. The level should be similar to those in CS:GO, using the provided sketch...to represent the wider environment, purely for aesthetic purposes. To establish the setting: the game is an FPS featuring team-based tactics, with players divided into two teams, Terrorists and Counter-Terrorists. It is similar to Counter-Strike 2, with objectives such as planting or defusing bombs, rescuing hostages, or eliminating the opposing team. Please use only free assets from the Unreal Shop and consult with me if necessary. Additionally, provide a list of the actions taken with the lighting and post-process effects added to the map as it will be used for educat...
I am looking for a skilled and experienced person to create compelling and optimized product listings for my Etsy shop specializing in handmade beaded jewellery. The ideal candidate will have a strong understanding of Etsy’s platform and SEO practices, with a creative flair for writing engaging product descriptions that attract and convert potential buyers. They will prepare the listings based on the photos and basic info about the product provided by me. Key Responsibilities: Make new listings and optimise existing ones - Title Creation: Develop clear, descriptive, and keyword-rich titles for each product. - Photo Selection: Ensure high-quality photos (provided) are used effectively in listings. - Description Writing: Write detailed and engaging descriptions, including: ...
I have online shop of fashion jewellery on Etsy and I am based in the UK. I need to boost my jewellery shop sales and I'm looking for a skilled marketing professional who can help me with this. Key Project Details: - The main goal here is to increase sales but also build brand awareness and drive traffic to my shop on Etsy -- I currently use Facebook, Instagram, and Pinterest for promotion, but I'm open to exploring other platforms if you have suggestions - My target audience is women all over the world but especially UK,USA and rest of the Europe Ideal skills and experience for this job include: - Proven experience in social media marketing, particularly in the e-commerce space - Strong understanding of the Etsy platform and its audience - Abilit...
Image Editing Project: - 59 Images Edited ( With Watermark ) - Listed on the website - Shop pages - Products listed
I’m seeking a professional to help me design and construct an interactive, art-focused coffee shop within a space of 1800 sq ft. My vision is centered on establishing a cozy and intimate oasis that offers a unique customer experience through blending Interactive art with coffee and culture of all kinds. Key elements of the project: - Implementing digital art exhibits: We seek Innovative designs that will incorporate digital art installations. Sculpture art and Painting display installations will have dedicated spaces to them. Applicants should let their creative juices flow in the design of this project. Imagine a plant-woodsy and geometrically enticing creative space. An added advantage would be experience with coffee roasting or coffee plant/flower themed i...
...build a business account on Facebook and link to Instagram to create an instagram shop for my business on both Facebook and Instagram. The central aim is to drive conversions and sales via these platforms. • Expertise Required: - Social Media Management - Facebook and Instagram Ads Management - Digital Marketing Strategy • Work Description: - Setup business profiles on both platforms. - Develop and integrate a catalog of my physical products. - Link the catalog to the respective platforms for direct sales. Ideally, the freelancer should have a strong background in sales conversion strategies using social media platforms, and experience with product catalog creation and integration. This project requires precise, effective work to ensure the fu...
...textiles are collected from our Big Mouth Donation bins. We are an environmentally green company without the greenwash. Job Description Trans-Continental Textile Recycling Ltd. is looking for a creative graphic designer to design decals for our donation bins placed all around the lower mainland and in Calgary. The ideal candidate must have a minimum of 3 years of experience with either Sign Shop and/or Print Shop and Adobe Illustrator. Knowledge of how to use a Roland TrueVIS VG540 would be highly valued. This position is perfect for an individual looking for a part-time job that allows for a hybrid opportunity allowing you to design at home and print in the office outside of regular office hours. Responsibilities: Primary Responsibilities: • Provide an estim...
My name is Seda Karadağ. I'm opening a new bridal shop. I want to create a new brand with the name Seda Karadağ. My name will be the brand name. I want brand and logo design. I will use the logo design on the sign of my workplace. The photo of my workplace is attached.
...looking for talented designers to create new, from scratch modern vial mock-ups for our entire product line. The goal is to achieve a design that combines icons and text with a focus on simplicity, sophistication, and alignment with current design trends. The mock-ups should be visually appealing and consistent with our brand identity. Project Requirements: Design and Color Scheme: Should align tastefully with our website (). We are open to suggestions regarding the color scheme. Mock-ups Needed: New mock-up photos are needed for ALL of our store items. Please refer to the attached examples for inspiration. Design new vials layouts, do not resuse our existing photos. Deliverables: The contest winner will provide mock-ups for all products in our store and
...design customization - Proven expertise in API for manufacturer - Able to meet for daily sprints during United States business hours, Central Standard Time zone. Please only apply if you have a portfolio demonstrating your successful completion of similar projects. PROJECT - $500 We will not respond to offers higher than the project price. VIDEO - we will provide a video for you to watch BEFORE we award the job CALL - after you view the video, we will schedule a call CANCELLING A PROJECT - if set timelines are missed, the project will cancel WOO BEFORE GO-LIVE TACTICS Woo site [store] 1. View cart and checkout – just few things, Apple Pay, Google Pay, specials 2. Add last 75 products - Excel 3. Add banners created, make responsive [786 pixels]...
I am contacting you regarding the assist 2 Bank can be in UK or any country worldwide, except USA / US bank 3 We want to open 2 accounts for Seychelles IBC comp.(the company hasn't start trading yet, because it doesn't have a bank account. We plan this SEY company will be the owner of websites, and 2 accounts for UK LLP company (they will sell e-shops book and e-shop BAZAR (ads classified)). 4 The owner of SEY company is a resident of China, UK LLP owned by EU citizen
I'm in need of a minimalist logo for my tailor shop. The ideal candidate should be able to design a modern, simple logo that captures the essence of my business without any excessive elements. Key requirements: - Experience in creating minimalist logos - A portfolio that demonstrates an understanding of modern design and brand representation - Ability to deliver a versatile logo that can be used for both online platforms (like the website and social media) and traditional print materials (such as business cards and brochures). I'm looking for a professional who can bring their creativity and expertise to the table. A strong sense of aesthetics, combined with an understanding of brand representation, will be highly valued.
I am looking for someone who can design pages of a hat online shop. I am not in need of a developer. you must be creative and use inspirations from the likes of new era and topperz. Please note, i need someone who has is very creative and has an eye for quality designs. The home page will be your first trial. If you are able to design a good home page you will be asked to design the rest of the other pages required. We also will require the automated emails and invoices designed too. Please bare in mind that these designs will be taken by a developer and implemented for use on the website.
I'm seeking a professional to aid in the architectural and design plan of a small dental surgery. Key Responsibilities: - Develop a practical, efficient layout for 2 operatories - Sterlization room - staff room (kitchen) - Incorporate a waiting area into the design Ideal candidate will have: - Proven experience in similar healthcare projects - Proficiency in archit...small dental surgery. Key Responsibilities: - Develop a practical, efficient layout for 2 operatories - Sterlization room - staff room (kitchen) - Incorporate a waiting area into the design Ideal candidate will have: - Proven experience in similar healthcare projects - Proficiency in architectural & interior design - A demonstratable understanding of dental clinic needs. The area is 83 sqm (shop number...
I am looking for an individual or team to assist me in developing a comprehensive online presence for my branded fragrance business. I need assistance with e-commerce setup, logo design, and SEO optimization. Key Responsibilities: - E-Commerce Setup: Assist in building an intuitive and effective online shop. Key features include product catalog, shopping cart, and seamless payment gateway integration. - Logo Design: Create a logo that embodies the essence of the brand - elegant, sophisticated, and memorable. - SEO Optimization: Enhance the website's visibility and ranking on search engines through effective SEO strategies. Additional Expectations: - Marketing Strategy: Develop a comprehensive marketing strategy covering all aspects of digital marketing including Google Adword...
I'm looking for a specialist to develop an auto repair shop management software. The software's primary goal is to track and bill for services rendered. I'm looking for a system with two user roles: - Administrator - Mechanic The software also needs to integrate with: - An accounting system - An inventory management system - A billing system Ideal candidates for this job will have experience in developing similar software. They will need to understand the unique requirements and workflows of an auto repair shop. Understanding the importance of accurate tracking, invoicing, and integration with other key systems is vital. Strong skills in the chosen development platform, attention to detail, and superb communication skills are a must.
Dear Mr. Mohsin, Task: Draw the ELV (Electrical, Low Voltage) shop drawing for the hypermarket project as per the architect's CAD file and the comments we have discussed previously. Project Details: The hypermarket consists of 2 floors: Ground floor: Hypermarket & offices First floor: Store The ELV shop drawing should cover the following systems: - CCTV - Network (Data & Phone) - Sound system (Announcement system with multi-zones) - Door Access - Wi-Fi APs - Server Room
I belong to a Stationery company. I want to sell products in the global market for which I require data of Distributors/ Dealers / Retailers such as Name, contact numbers, email id, shop address, coordinates, google rating etc. from google , amazon, cocoblu, flipkart etc along with all major websites related to stationery .
I'm in need of a digital artist to copy an existing simple design, with minor changes to text only. We have a tote bag that is old and tired now but I would like to remake it. I have included a scan of the current bag, three close up photos and one photo of the overall bag. I would just...black and white recopy of the original artwork with clean lines which I will print between A4/A3. The final box (lower right side) is currently an advert for the original coffee house (something like "Haasbrock..." but it's faded.. I would like it to say "a yawn is a silent scream for coffee" in the same font as the other boxes but I don't know if it is too long. Fyi - the bag was a from a shop in South Africa which has now closed, so I can't repurcha...
Seeking a seasoned graphic designer to concoct an elegant and sophisticated logo for my coffee shop, Barista. Our aim is to depict our brand as not just a coffee shop, but a rendezvous of elegance and sophistication. Key requirements include: - A deep understanding of the aesthetics intrinsic to coffee culture - Proven experience in logo and brand design - Ability to communicate elegance and sophistication visually - Good Knowledge of modern design trends in the coffee industry - Ability to finish work in a timely manner Prior work with coffee shops or similar industries will be given priority. Kindly include applicable work samples in your proposal for consideration.
I'm looking for a skilled video editor who can work on a dynamic and fast-paced Video Sales Letter (VSL). The final product should be 10 minutes or more in length. Key Requirements: - Edit VSL into a dynamic and fast-paced style - Incorporate engaging text overlays to emphasize key points - Add suitable special effects to enhance the overall video - Integrate background music to create a compelling and engaging atmosphere Ideal Skills: - Proficiency in video editing software - Previous experience in creating VSLs or similar marketing videos - A keen eye for detail and storytelling - Ability to maintain a fast-paced video without compromising clarity or message - Strong communication skills for feedback and revisions. If this sounds like a task you're capable of, please get i...
...we have remodeled and revamped the space we are a printing and copy shop but we have so many other services that we provide. I already have the domain name that I would like to use for my business Key components that need to be integrated into the homepage include - Testimonials: Displaying positive feedback and comments from satisfied clients will help in building credibility. - Featured Services: A section that highlights my main services or products, showcasing their value and benefits to the visitors. - About Us: This section should provide a clear background of my business, including its history, mission, and values. as well as a section that allows them to contact us through email The ideal candidate for this project should have experience in: - Developing interac...
My project requires an experienced programmer who has the technical abilities to modify an XSL style sheet and adjust its layout. The task will specifically focus on: - Changing the layout of the style sheet and VB code. This modification is needed to appropriately accommodate some new fields that have been added to an import file. - Improving the style sheet so as to automatically map the new fields from the import file. The ideal candidate for this job should have experience with layout adjustments in XSL style sheets, automatic mapping of new fields and VB coding. Your skills and experience in rearranging content layout, updating fonts & colors, and altering data display formats will be highly appreciated. Don't hesitate to place your bid if you can de...
I need advanced level steel shop drawings to begin the fabrication process. Here's what's needed: - Shop Drawings Detail: I require a meticulous approach, ensuring all the details required for a general contractor and architect to sign off are included. - Format: I need the final drawings to be delivered in PDF format. - Inclusive specifications: The final shop drawings should include the material specifications, welding symbols, and bolt connections details. Ideal candidates for this project should have experience in creating detailed steel shop drawings and a good understanding of the fabrication process. Proficiency in AutoCAD is a must, as well as a keen eye for detail. I'm in need of detailed steel shop drawings that are gea...
I'm in need of a creative designer who can craft a vibrant and appealing combination logo for my meat shop. The design should incorporate: - TEXT IS FINE with name "Village Meat House" - Warm color scheme (reds, oranges, yellows -MANDATORY) to make the logo feel inviting and appetizing. The ideal candidate should have: - A proven track record in designing combination logos. - Strong understanding of color psychology and how it can be applied to branding. - Experience in creating abstract icons and symbols. - Ability to take abstract ideas (like representing different meat types) and translate them into visually engaging designs. Sample pic attached. as per attached image. 2. top portion will be red. portion will be yellow. you can try with orange color also. 4...
I am in need of a...skilled freelancer who can help me extract all products from an online shop and import them into my Shopify store. Key Responsibilities: - Extracting all products from an existing online shop - Importing/copying these products into my Shopify store I expect the freelancer to: - Ensure all product information is correctly ported over like variants, prices, ean/gtin, description, collections,... - Maintain the quality of product listings - Ensure the product images are not lost during the import I'm looking to work with someone who has: - Experience with product extraction and import - Proficiency in Shopify - Attention to detail Please provide a timeline for completion when bidding. Please check the size of the shop and the number of produc...
I'm looking for a talented UI/UX designer to revamp the user interface and experience of GLOCYBS, a one-stop cyber security shop tailored for IT professionals. The design needs to prioritize intuitive navigation and a strong visual hierarchy, ensuring that users can easily find their way around the platform. Key Responsibilities: - Analyze and understand the current design, and suggest improvements to enhance the user experience. - Create wireframes, prototypes, and mockups that effectively communicate the planned user interactions. - Design a user-friendly interface that is both visually appealing and functional. - Develop a highly interactive design with dynamic content, providing users a unique and engaging experience. Ideal Skills and Experience: - Proven experience in UI...
Hi I am looking for someone to build us a gaming desktop computer E-commerce website with custom PC configurator. Things we need - Beautifully designed pages - Custom pc configurator and ordering this custom pc - Woocommerce - Payment integration - Listing Prebuilt gaming computers for shop Please send me your custom offers with details. Thanks
I'm in need of a skilled content writer and web developer to help me launch my e-commerce shop on Shopify. - The website is focused on selling Nail products. Therefore, I require engaging, SEO-optimized product descriptions and brand content to be written. - You'll be creating content from scratch, so a flair for creativity and a strong grasp of the English language is essential. - Beyond content creation, I also need assistance with loading it onto the Shopify platform. Experience with Shopify is a big plus. - Familiarity with e-commerce best practices, SEO, and the ability to write persuasively in a way that drives conversions is highly desirable. - A strong portfolio or samples of previous e-commerce content writing work is a great advantage. This is an exciting opp...
I need an experienced graphic designer to create a professional version of my existing logo for an ice cream shop. PLEASE MAKE THE LOGO AS CLOSE TO MINE AS POSSIBLE. THE "S" IN DELICES SHOULD LOOK LIKE AN ICE CREAM CONE. *** No more than 3 colors **** Please note: Must use same font and colors. must be very similar to example. No gradients only 3-4 colors that work with black or white background FONT: Key Requirements: - **Logo Redesign**: Transform the current logo into a more professional, eye-catching and memorable design that represents our business well. - **Color Scheme**: While I didn't select specific colors in the questionnaire, I'm open to suggestions that align with the ice cream industry