Text file merge vb punët
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
PLEASE CONTACT ME TO DISCUSS FURTHER
PLEASE CONTACT ME TO DISCUSS FURTHER
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I need a talented typist to help with a large-scale project. The task at hand involves typing numerous reports. These reports are not overly complex and do not require any advanced formatting or design work. Instead, basic formatting is all that is needed to give them a professional look. Key requirements: - Large volume of typing work - Typing and basic formatting of reports Ideal skills and experience include: - Proficiency in typing and formatting - Capability to handle a high volume of work - Attention to detail for accuracy - Experience with report typing is a plus
I'm seeking a developer to help me redesign the online text assignment plugin for Moodle. I'm looking to make the user interface more user-friendly and intuitive. This plugin should be rather simple as it is simply a redesign using elements that are already existing within Moodle pages by default Key responsibilities: - Redesign Moodle's online text submission type to improve user interface - Ensure the plugin is compatible with the latest version of Moodle Your qualifications should include: - Proficient in PHP, HTML, CSS, and JavaScript - Experience working on Moodle plugins - Strong understanding of user experience (UX) design The ideal candidate will be able to deliver a high-quality, user-friendly plugin that enhances the text assignment experien...
I'm in need of a skilled prog...programmer to create an automation code page for me. This code page will be focused on text processing, so a strong understanding of working with textual data is essential. Key Requirements: - Proficient in JavaScript: The automation code should be written in JavaScript to ensure compatibility with other platforms. - Automation Experience: The primary function of this code will be automating tasks. A proven track record in building automated processes is highly desirable. - Text Processing: The code must be able to accurately and efficiently process textual data. Experience in this field will be a huge advantage. If you have experience in JavaScript, a background in automation, and a strong familiarity with text processing, I...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
I'm looking for a small change on the attached advertising banner ae. I need someone to simply update the text from "2015" to "2024".
I am seeking an experienced logo designer to create a vibrant, colorful logo for my brand. It should incorporate both text and symbolic elements. The specifications are as follows: 1. Logo Type: - I require a combination of text and symbols, which should strike a perfect balance and are easy to comprehend. 2. Key Elements: - Please note, no specific elements are mentioned for the symbol part. I value your creative input in this regard. 3. Color Scheme: - The logo should radiate energy, hence vibrant and colorful scheme is mandatory. Your choice of colors should be harmonious and make the logo pop. Ideal candidates would have extensive experience in logo design, with a portfolio showcasing a diverse range of styles, especially vibrant color palettes. Creativity a...
I need an experienced graphic designer with an understanding of aesthetic logo and letter pad designs to create an innovative, custom design. Key Requirements: • Create a text-based logo with symbol elements. The design should be distinctive and contemporary. • Use a color scheme of blue and gold. Specifically, the design should feature blue letters with some elements in blue, while others should be in gold. My preference is for a vibrant, rich tone that ensures the design remains prominent and visually appealing. • Follow the examples provided in the attachments for the symbol elements to be incorporated into the design. The symbol chosen should reflect our brand and communicate our identity effectively. Ideal Skills: • Graphic Design • Brand Identity...
I need a command-line program that can convert .mpz files to .xlsx files. The program should be written in Python. If anyone can do it, please send me the message. Key Requirements: - Input: The program should take a .mpz file (protected password) as input. - Output: The extracted files should be converted to .xlsx format. - Handling: The program should be able to handle files up to 200mb in size. Skills/Experience Required: - Proficient in Python programming - Experience with file handling and conversion Note: A graphical user interface is not required, the program should be command-line only.
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
i have one php script which used to load in a few seconds now takes 4 minutes not sure why it suddenly lags need optimised - the mysql query hittin some bottleneck somewhere by looks of it
I have a project that entails exporting contacts from one database and merging them in a particular manner. Here's what I need: • Transferring data between databases -- changing to a new program • Combining the Excel rows into a single cell. Only the address, city, state, zip into one cell. Name, phone, email will stay separate. • The final format for the merged data should be in CSV. Ideal skills and experience required for this project include extensive knowledge about Excel functionalities, CSV formats, and database management. Previous experience with contact data transfer and merging will be highly appreciated. Let me know if you've done similar jobs in the past.
...familiarity with Windows, macOS, and Linux is ideal. - **Purpose**: The primary aim of the deployment is for text ebedding (vector db) and generation. - **Requirements**: Specifically, I'm looking for functionality related to Language modeling and retrieval augment generation in the LLM applications. - mongoDB should be set up runining a .sh file - docker-compose deploy of the app Essential skills for this project include a strong background in Python programming and experience with deploying applications on different operating systems. Previous work in natural language processing (NLP) or machine learning operations (MLOps) will also be a strong advantage. Your understanding of text generation and the specific functionalities mentioned will be key to the suc...
I have a large batch of text data in PDF files that needs to be copied and pasted into a specific format. Key Requirements: - Transfer text data from various PDF files - Ensure accuracy and precision in the copying - The time-sensitive nature of the task - The data must be transferred into a format that is easy to work with Ideal Candidate: - Proficient in using PDF files - Strong attention to detail - Previous experience with data entry/copy-paste tasks - Ability to work under time constraints
I have a project that entails exporting contacts from one database and merging them in a particular manner. Here's what I need: • Transferring data between databases -- changing to a new program • Combining the Excel rows into a single cell. Only the address, city, state, zip into one cell. Name, phone, email will stay separate. • The final format for the merged data should be in CSV. Ideal skills and experience required for this project include extensive knowledge about Excel functionalities, CSV formats, and database management. Previous experience with contact data transfer and merging will be highly appreciated. Let me know if you've done similar jobs in the past.
I need a Python script that can batch process text overlay onto images (jpg/png). All the images and all the text will be unique. Each set of text(s) (1-2 sentences) will have its own unique image. (one-to-one) I would like to have a CSV file containing all the unique sets of text. The script would reference a folder of images. The script needs to be able to handle 20-200 images. I would like to be able to change the font style, size, the position on the image, and to have the text be able to wrap to the next row on the image.
I'm in search of a talented tattoo artist who can create a unique blackwork tattoo design for me. NOTE: The design is to be based on an existing tattoo (photo is attached, must incorporate this tattoo), but expanded upon with a fresh blackwork twist. ... particularly blackwork style. It's crucial that you've got a keen eye for incorporating sacred geometry and symbolism into your designs. Key Points: - Proficiency in blackwork tattoo style - Ability to artfully incorporate sacred geometry into the design - Understanding of creating symbolism in tattoos, particularly representing enlightenment and spirituality Your creativity and ability to merge these elements will be essential in completing this project. A transfer sheet will be required upon awarding. Looking for...
I'm looking for a skilled freelancer with experience in image stitching using OpenCV. The primary goal of this project is to merge two images into a single image. Project requirements : You will be able to choose 2 grayscale images from the graphical interface. The images will be read from the disk and displayed, and the mouse will be used to choose corresponding points on the images (at least 3). Pairs of dots will be marked with crosses of the same colour in the images, but distinct (random choice of colours) for each pair. After pressing a key a third image will be displayed containing the first image pasted to the second image on a black background. For this, the image registration algorithm will be implemented, which calculates the geometric affine transformation based...
Hey mate - like the project that you did before for me I now need, urgently, 2 more cards: THE MOUSE IS OUT AUGUST 6 and THE IS NOT THE FUNHOUSE Can you do this ASAP??
I have a photo of a medal that I would like to have converted to a svg file for printing. I want the outlines of the kings head, text and contours in black. Also the clasp with the text *1858 Gustaf V †1950 in black. The ribbon should be black also. Show examples and the best one gets the job.
I'm seeking an expert audio engineer who can produce a high-quality WAV sound format file that records music in gigabyte quality. The resulted file needs to be compatible to play on various platforms including but not limited to YouTube, Spotify etc. Specifics: - The file should offer unlimited recording capability, with no restrictions in terms of length. - Must possess proven experience in music editing and file formation. Skills in working specifically with WAV formats is a plus. - Familiarity with audio quality requirements for various platforms (YouTube, Spotify, etc.) is crucial. The importance of quality, compatibility, and versatility in this project cannot be overstated. Applicants should bid with relevant portfolio samples demonstrating the abi...
I'm in need of an expert to help me create a 3D STL file for a wood carving project I'm planning to run on my CNC machine. Key Requirements: - The 3D model should be suitable for wood carving, ensuring it's conducive to the CNC machine's operation. I use vetric aspire and the file is for a wall decor - I'm looking for detailed, intricate designs that would look appealing once carved. Ideal Candidate: - Proven experience in creating 2.5D and 3D STL files for CNC wood carving. - Proficiency in understanding the constraints and requirements of CNC machines. - Creative and skilled in designing intricate patterns and shapes. - Strong attention to detail to ensure the final product is of high quality and visually appealing.
I require a one-time data scraping project completed on multiple websites. - TASK: The task involves scraping text content from: Google searches: Commercial Real estate agency Saudi Arabia Commercial Real estate agency UAE Commercial Real estate agency Qatar Commercial Real estate agency Kuwait Commercial Real estate agency Bahrain I have made a start to the spreadsheet with a template for each of the regions which can be continued to be filled in. In the Google searches, just take the first 3 pages with the main agent listings and see what agent names/ email addresses you can find. - DATA REQUIRED: The primary data needed is text content. - TIMELINE: This is a one-time task, with no ongoing scraping requirements. Skills/Experience: - Proficiency
I have two websites that need to be merged with a main focus on consolidating information. The current websites are different in design and themes, and I'm looking for a professional who can successfully merge them into a cohesive, user-friendly site. Key requirements: - Consolidate information: The primary goal is to combine and organize the content from both websites into a single, easily navigable platform. The new website should provide a clear and seamless user experience. - Prioritize by relevance: The content should be arranged in a way that is most relevant to the user. This may involve restructuring and reorganizing information to ensure that the most important details are easily accessible. Ideal skills and experience: - Proficiency in website design and deve...
I'm looking for a talented CGI or VFX specialist to enhance the visual appeal of a banner. The purpo...the visual appeal of a banner. The purpose of this enhancement is to create a captivating effect that evokes a futuristic and technological atmosphere. Key Elements: - Realistic Textures: I envision the final product to have a tactile quality that's close to real life. - Dynamic Lighting Effects: A play of light and shadow is essential in achieving the futuristic vibe. Your role will be to merge these elements seamlessly into the banner to create a cutting-edge, visually striking piece. This project will not only require technical skills, but also a keen aesthetic eye for detail and coherence. Experience in similar projects or a strong portfolio in CGI and VFX will be...
Ein bestehendes XML File das dem Isybau XML Austauschformat entsprechen muss soll mit einem einfachen Python Script überarbeitet werden. Das Austauschformat gibt vor das im Block <Inspektionsdaten> nach jeden <KZustand> mit dem Untererlement <InspektionsKode>DCA</InspektionsKode> ein dazugehöriger <KZustand> mit dem Untererlement <InspektionsKode>DCG</InspektionsKode> folgen muss. Die <KZustand> Blöcke sind vorhanden aber die Reihenfolge stimmt aktuell nicht immer <Inspektionsdaten>. Das Skript soll die richtige Reihenfolge herstellen. Nach jedem DCA muss der dazugehörige DCG kommen. Dabei müssen die Unterelemente <VertikaleLage>, <Frame>,<PositionVon> und <PositionBis> über...
I'm in need of a skilled logo designer to create a text-based logo for my brand. Key Points: - You should have a strong background in graphic design with a particular expertise in logo design - Experience with creating text-based logos is a must - Ability to suggest and implement fonts that convey creativity and innovation is highly valued - Strong communication skills to understand and translate my brand values into a visual representation Feel free to include a link to your portfolio showcasing similar work. Looking forward to seeing your creative ideas.
I'm in need of a data entry clerk who will be working with text data and will organize it by category. The data doesn't require validation or verification, just simple categorization. Ideal candidate should: - Possess excellent attention to detail - Be proficient in data entry - Have experience working with text data - Be able to categorize information effectively This is a fairly straightforward task that requires precision and organization. I'm looking forward to working with someone who is reliable and meticulous in their work.
As a diligent user of Google Drive, I'm seeking a proficient developer who can create a program using Google App Script to arrange my Google Drive files in a hierarchical manner. Let's make searching and organization efficient and automated!...searching and organization efficient and automated! the specific features I am looking for well be explained in private The ideal freelancer for this project would have extensive experience with Google App Script and an understanding of how Google Drive works. You should have created similar file management tools previously, and have a knack for creating user-friendly interfaces. Efficiency is key, as is the ability to work on a tight timeline. I look forward to working with a problem-solver who can make my file management...
I have a series of brief game videos that I'd like to merge into a single dynamic and engaging advertisement for my Game. The individual videos are all under a minute in length and I'm looking for a fast-paced, energetic style of editing. I have created this video: I rate it 4/10. I expect yours to be at least 8/10. Deliverables: - Primary Video of 30 seconds in Portrait and Landscape - Secondary Video of 15 seconds in Portrait Resources: 1. Videos are attached. If you do not find them interesting, I can attach more 2. Game Name: "Patterns Puzzle Game" 3. Game Platform: "Android, IOS" 4. Keywords: Relaxing, Interesting, Puzzle, Patterns, Tough 5. Ping me for more details. Key Requirements: - Combine multiple, short videos into one cohesive
Logo Design Contest for Texoma Logistics Innovation Engine Description: We invite talented graphic designers to participate in our contest to redesign the logo for our Texoma Logistics Innovation Engine project. We are looking for a design that simplifies our current logo while retaining a bold and expressive style, suited for a futuristic concept that embodies logistics and innovation. Design Requirements: - Style: Futuristic, yet clean and professional. - Elements to Include: - All four modes of transportation: freight truck, drone, speed train, and cargo ship. - A circular motif. - Color palette: light blue, dark blue, white, and black. - Exclusions: Absolutely NO AI-generated drawings. Original designs only. And please do not give us the exact same design as we before. Final D...
I need a Python Selenium application that can scrape blog posts from Site A and post them on Site B. Key Requirements: - The Python app should be built using Selenium for web scraping and automation. - It should be able to extract blog posts from Site A, specifically. - The extracted data must be posted on an existing blog section of Site B. Ideal Skills & Experience: - Proficient in Python, with experience in building web scrapers. - Strong knowledge of Selenium for web automation. - Previous experience with data extraction and manipulation. - Understanding of web protocols and site structures. - Familiarity with blog post formatting and publishing is a plus.
I'm looking for an Android developer to enhance my app to support zip and rar files. The functionality should include: - Support for both zip and rar files - Support for both password-protected and standard files - Ability for users to extract files - Ability for users to view file contents The ideal candidate should have experience in Android app development, specifically dealing with file handling and storage. Knowledge of third-party libraries for handling zip and rar files is a plus. The developer should also be comfortable with implementing password protection mechanisms. Please note that the app is already built, so the task would primarily involve adding the requested functionality.
...the main entry point for users. It should be user-friendly and intuitive. - Document Import: Users should be able to import documents into the application. - Document Merging: The app should have the capability to merge documents. - Text Processing: The application should be able to process text. File Formats: - The app should support the following file formats for document import: PDF, Word (docx), and text files. The ideal candidate for this job should have: - Proficient in both iOS and Android app development. - Experience with document processing and merging. - Knowledge of file format compatibility. Please provide samples of your previous work, especially if you have developed applications with similar features. The Db is alread...
...designer to create a mockup ad promo keeping a calm and professional tone. This project will focus predominantly on text animations with an occasional presence of other elements. Key Deliverables: - The mockup should be designed around text animations, and such animations must be of high quality and engaging. - The ad promo should have a calm and professional theme, consistently appealing to everyday consumers. - Although the emphasis is on text animations, if applicable, feel free to incorporate creative ideas that will increase the appeal to our targeted audience. Ideal Skills & Experience: - A strong portfolio showcasing your prowess in After Effects, especially in text animations. - Previous work on ad promos geared towards everyday consumers will b...
I'm seeking an experienced freelancer with strong attention to detail to perform data entry into my database. The data to be entered is text-based and extracted from various sources which may have distinct formats. Below are specifics about the job: - Handling Text Data: The job will entail entering a variety of text data into the designated database. - Format Diversity: The data comes from diverse sources, so it does not adhere to a specific format. The ideal candidate must be adaptable in handling different data formats. - Correcting Discrepancies: The freelancer will need to spot and correct discrepancies or inconsistencies within the data sources. Accuracy and keenness to details will be crucial. Ideal Skills: - Proficient in data entry - Strong attenti...
I have a 1-page Excel spreadsheet with 9 text columns that need to be merged. I'm looking for someone who can start this job immediately and has experience in Excel data manipulation and formatting. Please only bid if you can do this job immediately and I will award and give you the file.
one page with about a paragraph of text (Single page)
I'm looking for a professional who can help me in adding text to an AI-generated logo. The text should be seamlessly integrated within the logo while maintaining a modern style. Key Requirements: - Add text to an existing AI-generated logo - Integrate the text within the logo design - Ensure the design maintains a modern style Ideal Skills and Experience: - Proficient in graphic design and logo creation - Experience with AI-generated design modification - Able to seamlessly integrate text into visuals What I want is the red B in the backgroud to read BBK., The second B can be a shadow copy and the K perhaps also to the back so that not all is visible but it should clearly read BBK. Please provide a quote for this modification along with samples ...
I'm in need of a creative logo designer who can craft a unique and visually appealing logo for my new automotive business. The ideal candidate will have a good understanding of modern and vintage design aesthetics, and the ability to merge these two styles seamlessly. Key Requirements: - Modern and Vintage Style: The logo should reflect a blend of modern and vintage design elements. - Warm Tones: I prefer warm color tones such as reds, oranges, and yellows. - Automotive Theme: The logo should incorporate elements or symbols that are related to the automotive industry, but the design approach should be creative and unique. Ideal Skills: - Proficiency in graphic design software. - Strong portfolio that showcases creative and unique logo design work. - Excellent understanding of...
I have a bulk of digital files that need to be accurately transcribed into a digital format. The files are all in English, so proficiency in English is necessary for this project. Ideal skills and experience include: - Proficient in English - Fast and accurate typing skills - Experience with data entry
I'm looking for a skilled developer to help integrate the DropzoneJS library into my project in full. I have integrated demo vesrion only. The primary goal is to improve the user experience by allowing for drag and drop functionality for file uploads. Key Requirements: - Implementation of drag and drop functionality using DropzoneJS - Ensuring DropzoneJS supports multiple file uploads at once - Do not need integration within the existing project structure. PHP Upload script working just fine. - Adherence to best practices for user interface design and user experience Ideal Skills and Experience: - Proficiency in JavaScript and relevant libraries, particularly DropzoneJS - Proven experience with front-end development and UI/UX design - Ability to integrate new function...
Build an AI based tool that has auto voice dubbing and auto voice separation for my videos and Auto dubbing for over foreign 80 languages with close captioning text and an AI-based tool that automatically animates, lights and composes CG characters into a live-action MP4 video scene in AI and Machine learning. Build AI based tool for auto dubbing, close captioning text, Create Professional custom 3D Character animates, lights, and composes CG Robot and Alien and creates custom Voices for the video 3D Robot & Alien characters. You will need to help me create any needed AI access and License accounts. I am seeking a proficient developer to create an AI-based tool that automatically animates, lights and composes CG characters into a live-action scene using AI and M...
I need a freelancer to help me type text from digital files to an Excel spreadsheet. - The data you will be typing is textual in nature, with the content coming from digital files. The final output should be an organized and error-free Excel spreadsheet. - Attention to detail is crucial. The ideal candidate for this job will have experience with data entry, exceptional typing speed and accuracy, and a track record of working efficiently with digital text and Excel. Please be sure to include any relevant experience and your estimated timeframe for completing this task.
I'm looking for a Photoshop expert to help me with editing two photos for personal use. I need the following done: - Add text in the center of each photo - Remove unnecessary objects from the photos The skills required for this job include: - Proficiency in Photoshop - Attention to detail - Experience with photo editing - Creative thinking to make text additions look natural Please note that the purpose of these edits is for personal use so they need to be visually appealing and well executed. It will be necessary to ensure that the text additions blend seamlessly with the rest of the image.