Send text file printer vb net punët
I need someone in Tirana to visit several shopping malls and send me some pictures and information. More info after I award the project. It will be one off visit, and not more than 10 pictures. Kam nevojë për dikë në Tiranë për të vizituar disa qendra tregtare dhe për të më dërguar disa fotografi dhe informata. Më shumë informacion pasi të jap çmimin e projektit. Do të jetë një vizitë dhe jo më shumë se 10 fotografi.
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
PLEASE CONTACT ME TO DISCUSS FURTHER
PLEASE CONTACT ME TO DISCUSS FURTHER
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
miredita shqipe pom duhet me qu shum emaila ndoshta munt te mundesh mem ndimuu te pershendes me tmira
...critical in my firm, making improved billing and invoicing features a must. The software is principally used for case and document management and time tracking to organize our work effectively. The ideal candidate for this job is one with Laravel experience as well as familiarity with law firm operations. A strong sense of UI/UX, client management systems and invoicing systems is also crucial. Printer-friendly fyy}...
I'm looking for a skilled developer to create a C# web application. Key Requirements: - Fluency in C# programming language - Proficiency in web application development - Experience with .NET Core, Xamarin, or Unity frameworks is a plus - Familiarity with web application technologies and best practices It's a plus if you have prior experience in building web applications, but not necessary. The most important aspect is your ability to understand and implement the project requirements effectively. A good grasp of C# and web programming is a must.
I am looking for a skilled developer with strong experience in AngularJS and understanding of Azure board. Key Responsibilities: - Implement user authentication, form validation, and API integration using AngularJS - Ensure the components are designed in accordance with Material Design Skills and Experience: - Proficiency in AngularJS and .NET is a must - Solid understanding of Azure board is desired - A good eye for design with a preference for Material Design - Prior experience in developing user authentication, form validation, and API integration functionalities is an added advantage. I look forward to your bids.
I'm seeking a talented translator to convert content from English to Arabic. This project involves translating a text document specifically. Key requirements and characteristics for the project's success are: - Proficiency in English and Arabic - Familiarity with a variety of professional jargon - Contextual understanding for accurate translations - Detail-oriented approach to preserve the original content's meaning Experience in translating similar documents would be very beneficial for this project. This job requires attention to detail and an understanding of both languages at a high level. Looking forward to receiving your bids.
...when the company IPOed). • Note that the task is to write a script or program to do this automatically, and not to download all files manually. • You can use the sec-edgar-downloader (https://sec-edgar-downloader.readthedocs. io/en/latest/) package in Python for ease or other similar packages. Task 1.2: Text Analysis • Note: You have to submit ONLY – The program is used to merge data, clean data, perform analysis, and generate visualization. The main task for this part is to conduct text analysis using LLM API available for free. • There are a few services that provide LLM inference API along with some free credits to use. You don’t need to use any paid service. • Use LLM inference API to gather some information or generate some insi...
...become a champion of company products and programs across all categories. Research product information, pricing, and offer information as needed to complete assignments. Collaborate with marketing, designers, developers, category managers, content authors, and other professionals on large- and small-scale marketing and ecommerce projects (e.g. email campaigns, social media posts, affiliate ads and net new landing pages). Edit and proofread copy as needed produced by other internal and external teams. Attend meetings to align on strategy. Qualifications: Proven experience (3+ years) as a B2C copywriter or related role, with expertise in marketing, content management, promotional and UX writing. Passion and dedication for a cohesive and well-articulated customer experience journey....
I'm using Microsoft Access 2013 and I'm looking for a skilled freelancer to help me integrate a Dymo printer into my system. Here's a breakdown of the project: - **Integration**: I need the Dymo printer to work seamlessly with my Access 2013 database. The goal is to automatically print stock labels based on query results. This means you'll need to set up the system to take the query output and send it to the printer for label creation. - **Printing Specifics**: The labels I need printed are stock labels. The process should be automated, so the labels are generated and printed without manual intervention. The labels will be printed based on the results of a query in Access and some limited entry from the operator with such things as qty of l...
...InDesign professional who has experience in editing text within this graphic design platform. For this project, the scope of the task involves: - Updating 4 sentences within the current design while maintaining the existing font style and size. The ideal freelancer for this job would have great attention to detail, proficient in text manipulations in Adobe Illustrator, and the ability to maintain existing design settings like fonts and sizes. It's vital that the overall aesthetics and visual appeal of the design remain untouched, focusing only on the text changes requested. If you could manage to make these changes seamlessly, I’d like to discuss this opportunity with you. The picture shows the few changes needed. The current InDesign file and ...
I'm in need of a talented logo designer to create a modern and minimalistic logo for my IT startup. The color scheme should predominantly feature #86B445 Color, but feel free to incorporate other complementary colors as you see fit. - Company Name: RAFSIN -- Must include the company name as well as a symbol or icon that represents our brand identity. You can use symbol or symbol and text style. - Company Category: It service - Color: #86B445 We provide web development and graphic services.
I am in search of a proficient Flutter developer to create a sleek, minimalist mobile app that transcribes speech to text. This sophisticated app should be able to transcribe word-for-word in real-time, with the added feature of allowing users to manually alter listening duration and intervals between words. While I am uncertain about multi-language support at this stage, I am very clear about cross-platform compatibility. This app should be constructed to operate seamlessly on both Android and iOS platforms. Key Requirements: - Expertise in Flutter development - Proven record in developing cross-platform mobile applications (Android & iOS) - A knack for creating minimalist and user-friendly interfaces - Experience in, or knowledge of real-time speech recognition technolog...
1. Hi, I'm looking for someone who is an expert in AlphaFold and protein structure prediction, as well as PDB data, I wanted to understand this RF diffusion paper, which uses AlphaFold. However, I don't quite understand the structure of the PDB data, especially when they talk about these XYZ coordinates and other biochemistry-related terms. If you could navigate me through the structure of PDB files and, if you happen to know more about AlphaFold, that would be great. 2. Please write the links to your google scholar page in front of your proposal please.
I need a professional to convert English voice not to Arabic text the voice from British council 3 Min.
W...platforms. Key Features Required: - Inventory Tracking: The software should efficiently track every piece of inventory and maintain records in real time. - Customer Management: It should have features to manage customer information effectively and to capture their buying trends. - Receipt Printing: The software needs the capability to print receipts after every transaction. - Kitchen Display/Printer: A feature that allows displaying orders in the kitchen and initiate printing commands accordingly would be highly beneficial. Freelancers with relevant experience in POS software development are particularly encouraged to apply. Please include a detailed description of your experience in your proposal. This will help us understand how your past experiences align with our proj...
I'm looking for an experience...users to select and manipulate files easily from the context menu, primarily focusing on file selection and type filtering. Desired files should be filtered by their type, such as "*.pas", without a dialog box. - File Manipulation: Once files are selected, users should be able to copy them to their preferred destination. - Delphi Version: The entire application should be developed in Delphi 10 or newer versions. Please make sure that the application programming is compatible with these Delphi versions. I will also need the source code in Delphi provided along with the application. This project requires extensive knowledge and expertise in Delphi programming, Windows application development, and file manipulation techniq...
I'm looking for an expert to write an academic paper focusing on the d...expert to write an academic paper focusing on the design considerations and optimization of a magnetron. This project requires: - Comprehensive understanding of magnetrons and their design intricacies - Ability to provide a basic CST file model of a magnetron Key elements should include: - In-depth research and understanding of magnetron design considerations and optimization - Expertise in creating and interpreting basic CST files - Strong technical writing skills for clear and concise academic paper While the academic paper should be in-depth, the CST file should provide a basic overview of the design. Having experience in electromagnetics and microwave technology would greatly benefit the exec...
We need to change our logo on a short MP4 video. Unfortunately we do not have the source files for the video, just the MP4 file, and we require the old logo to be replaced with our new logo.
We require an Adobe After Effects specialist to execute minor alterations to the text and add our logo in an already established AEP file. You can see the file we need to modify here: *i6g7w4*_ga*NjIzMDQ3MzQxLjE3MTQ1Nzc0NDE.*_ga_ZKBVC1X78F*MTcxNDU3NzQ0My4xLjEuMTcxNDU3NzUzMC4wLjAuMA..&_ga=2.75730709.1427531441.1714577441-623047341.1714577441 All we require is our logo added and some very minor text alterations.
File Utility Patent in Europe. As discussed during chat.
I am seeking the developer with advanced skills in API implementation, with specific experience with the BnP Paribas' API structure, as well as a strong proficiency in C# .NET. Project duration 3 months. Spoken language Greek. Key Responsibilities: - Establish a robust connection between our application and the BnP Paribas via their API. - Ensure successful transmission of specific data, Cash Account Info, Securities Account Holdings, Settlement Status, Transactional – FX.. Required Experience: - Strong proficiency in C# .NET - Proven experience in API Integration, preferably with BnP Paribas - Knowledge of JSON data format - Proven ability to work according to specifications and deadlines - Ability to test and troubleshoot the integration This project involves...
I have a basic, low-detail PNG image that I would like to convert into an STL file. This file will be used for 3D printing a simple, 3D object. Key Requirements: - Convert a single, low-detail PNG image into an STL file that is suitable for 3D printing. Other Considerations: - As the image is low-detail, the requirements for intricate texturing or complex geometries are minimal. The final 3D model should accurately represent the basic forms and shapes from the original PNG image. Ideal Freelancer: - Proficient in 3D modeling, specifically in converting 2D images into 3D printable files. - Familiarity with the STL file format and its requirements for 3D printing. Please provide a brief overview of your experience with similar projects and the tools you in...
Hi Md Sazedur R., I noticed your profile and would like to offer you my project. We can discuss any details over chat.
As a thriving business, we are in need of a captivating logo that perfectly merges text and imagery. This logo should communicate a strong sense of creativity. We'd like the use of Red, Green, Yellow, Black, and White to be prevalent across the design to align with our branding. This is for an entertainment and lifestyle app. Ideal Skills: - Expertise in graphic design - Strong background in designing creative logos - Proficient in colour theory, particularly with Red, Green, Yellow, Black, and White Experience Required: - Previous work samples of mixed-text image logos - Proven ability to convey creativity in designs and a knack for aesthetic appeal Get ready to unleash your creativity on this project. We're eager to find a freelancer with innovative ideas and s...
I have a straightforward task of copying and pasting text from online sources. Key Requirements: - Proficient at data entry, specifically copying and pasting - Ability to work accurately and at a good pace - Familiarity with online sources and handling of text Ideal Skills: - Data entry - Attention to detail - Fast typing speed - Internet research skills The task is not complex, but the ideal candidate will be someone who is detail-oriented and able to work efficiently and accurately.
I have a project that requires text data entry extracted from handwritten notes. This project entails meticulously transferring this data into a specifically structured format such as tables or lists. Key responsibilities include: - Accurate transcription of handwritten notes into digital format. - Organizing the data into tables or lists, maintaining coherence and clarity. Ideal skills for this project: - Excellent typing skills with high accuracy. - Proficient in the use of Microsoft Excel or Google Sheets. - Attention to detail is critical due to the nature of handwritten sources. - Experience in data entry from handwritten notes is preferable. Your main task will be taking the handwritten notes provided and diligently converting them into a designated structured format. I...
I have a set of handwritten notes that need to be typed up. The notes are very clear, so there should be minimal confusion around interpretation. I am looking for someone who can proficiently type...of handwritten notes that need to be typed up. The notes are very clear, so there should be minimal confusion around interpretation. I am looking for someone who can proficiently type handwritten text accurately and efficiently. The ideal freelancer for this project should have: - Excellent typing speed and accuracy - Experience with transcription or data typing - High level of attention to detail - Proficiency in English language Great care should be taken when transcribing to ensure the data is typed precisely as it appears in the notes. The final deliverable should be a digital ...
I'm in need of a professional who can convert a series of moderately formatted PDF documents into editable Word files. Key Requirements: - The purpose of this conversion ...moderately formatted PDF documents into editable Word files. Key Requirements: - The purpose of this conversion is to enable easy editing and updating of the content. Thus, the primary goal is to ensure that the translated text is accurately captured. - The PDFs contain a mix of text and images with basic formatting. The Word files need to retain this layout as much as possible, though some reformatting is acceptable. Skills and Experience: - Proficiency in PDF to Word conversion tools. - Strong attention to detail to ensure accurate content capture. - Prior experience with text and image ...
I'm in need of a Flutter developer who can help me bring my social networking app to life. The key feature of this app will be the ability for users to create and customize human avatars. The customization level required here is 'basic', so it will mainly include simple outfits and accessories. Key Requirements: - Flutter Expertise: You must have a solid background in Flutter development. - Mobile App Experience: Experience in building mobile applications is a must. - Social Networking App Experience: Previous experience in developing social networking apps will be highly beneficial. - Avatar Customization: Experience in implementing avatar customization features, although basic level is needed. Your role will involve working closely with me to understand the vision for th...
I am in need of a savvy individual with experience in PDF editing to help make an information update in my document. The task will only involve text editing - no image editing or page rearrangement duties will be necessary. Details: I need the following text changed. " EXISTING FLOOR PLAN" Changed to “FLOOR PLAN FOLLOWING ALTERATIONS, DEC 2023" Ideal Skills: - Acrobat Pro proficiency; - Attention to detail; - Excellent communication skills. Excited to work with someone who can preserve the integrity of my document while updating the necessary details.
I'm looking for a Django developer skilled in Django Rest Framework (DRF) to improve my existing website with some new functionalities. The features that need to be implemented include: - Translations - Templates - File exports - if you are good in developing a business logic I might consider this part also. Please no AI stuff, no stackoverflow developers, no "bat inklish". No agencies, only people with experience over 2 years in active development. I would only accept submissions that contain portfolio or skill sets based on these topics: (Web app security, Product management, Search, Emails, Payments, Invoicing, Shipping, Barcode scanner, In-store buyers, Translations, Analytics, Logging, *CMS) Accordingly, the main criteria (IMHO, up for discussion): ✅ Experienc...
I need to convert text documents into PDF files. The project involves: - **Content**: The documents are standard text with no special characters or languages. So, it's a straightforward conversion process. - **Formatting**: I'm looking for a professional who can ensure the PDFs are formatted in a clean, easy-to-read manner. You don't need to apply any special formatting or styles, just standard text formatting. - **Output**: The final output should be a series of PDF files that mirror the original documents in terms of text and layout. Ideal Skills and Experience: - Strong experience in PDF creation and conversion. - Proficiency in maintaining standard text formatting in PDFs. - Attention to detail, ensuring the final PDFs mirror the orig...
I am looking for a dedicated individual with extensive experience in developing .NET Blazor applications, Experience on working on Healthcare Application will be a plus.
I have a digital PDF document that needs to be converted into plain text - I'm looking to edit the content rather than preserve the formatting. I also need the content to be transferred into an Excel spreadsheet for further analysis and use. Key Requirements: - Extract text content from a digital PDF document. - Transfer extracted content into a structured Excel spreadsheet. - Ensure the formatting of the content is conducive for further editing and data analysis. Ideal Skills/Experience: - Proficient in PDF conversion tools and techniques. - Strong data entry skills, with a keen eye for detail. - Knowledge of Excel and experience in data structuring. - Ability to maintain the integrity of the textual content during conversion. - Familiarity with content editing princi...
1. Install this app. 2. select one logo. (Edit logo screen) need all functions / you can say a replica of that screen and function now I need this screen. where you can add new graphics, text, and bg. after that, when you add graphics, you see some functions like shadow, colour, curve, and more. I need the same option and function. check the details in detail. no fully functional app is needed. We just need a screen which offers logo modification functions. take your time and share me the list of which things(functions) are included and your best price for this project with the timeline. Thank you
I have a PDF document that needs to be converted into a simple text format. I will use automated spell check for accuracy assessment. Key requirements: - Convert a PDF document into text format - Ensure the output is devoid of formatting from the original document - Implement automated spell check to ensure accuracy Ideal Skills and Experience: - Proficiency in copy typing - Experience with document conversion from PDF - Ability to follow instructions for formatting - Familiarity with automated spell check tools Note: Bids with proposals on how you will maintain accuracy and quality during the conversion process will be highly regarded.
I am urgently seeking an experienced .NET developer who can address some bugs and error messages within my application. As I did not specify the nature of these bugs, the successful applicant should be confident in handling a broad range of potential issues within a .NET framework. Key responsibilities: - Identify and troubleshoot bugs and error messages - Ensure consistent operational efficiency post bug fixes Ideal Skills and Experience: - Strong proficiency in .NET development - A broad understanding of potential .NET bugs - Proven experience in troubleshooting and resolving .NET issues Due to the urgency of this task, a prompt response and quick turnaround time is highly appreciated.
As the owner of a brand with an existing logo, I'm seeking a design professional to help advance this image. My requirements are: KEEP LOGO DESIGN EXACLY THE SAME JUST CHANGE COLOUR OF WORD "PAY" TO BLUE LIKE ON OUR WEBSITE AND ADD THE BELOW WORDS "POWERED BY FISERV" I need 2 variations as per sizing below The sizing and format need to be. Idle Screen Logo: png or gif. 250 * 250 Receipt Logo: bmp or png. 290 * 63 We need the existing logo attached below but with the new blue colour on our website for the word Pay and then we need to add the words below it "powered by Fiserv" I have attached the Fiserv logo Below so it should read Cloud Pay (new colour) powered by fiserv (in orange like attachment)
I have a Google Docs document that I need converted into a Word file. The Google Docs document is a bit plain and could use a touch-up to enhance its visual appeal and professionalism. Key Tasks: - Convert Google Docs document to Word - Improve the current formatting - Enhance font style and size I need someone who understands the nuances of document formatting, especially in Word. The ideal freelancer for this job would have a keen eye for design and a good understanding of typography. A background in document formatting would be a big plus. Please include any relevant experience or portfolio samples in your bid.
I ...40X of your Project Bid whichever is higher. (Website Sale is not the net profit of the store) Key Points: - I'm a new Shopify store owner with ALL product listings at present but no Sale - My main goal is to create a store that converts visitors into customers, driving direct sales. - Store is Ready with all Social Media Accounts. Ideal Freelancer: - Experience with shopify store setup and optimization. - Strong understanding of e-commerce and what drives sales. - Proven track record of increasing conversions without relying on paid ads. Website URL: Note: Delivery will be expected only after the confirm sale of 2000$ or 40X of your Project Bid whichever is higher. (Website Sale is not the net profit of the store) (No Fake Promise or No work on other Direction...
... expert who can fix issues relating to text alignment on my canvas. What I need - 1. The text should be always in the center position within the wrapper. 2. There will be a variable that has 3 options: a) automatic b) shorten c) line break. if the variable value is "automatic" - Then the text should be in one line whatever the text length it is. That means you need to decrease the font size accordingly. if the variable value is "shorten" - Then the text should be in one line too but if there is no space at the end it will cut the text. if the variable value is "line break" - Then the text should go to the next line if there is no space at the end. **** I have uploaded a zip file. Here all th...
I am representing a capital asset management firm that offers wealth management, investment advisory, and financial planning services to individual investors, high net worth individuals, and institutional clients. We are in need of a comprehensive website that showcases our offerings and team. Key Features: - Overview of Services: A clear description of our wealth management, investment advisory, and financial planning services. This should be accessible to individuals and institutions. - Investment Strategies: We wish to share the investment strategies we employ in a clear and understandable manner. - Team Members and Expertise: We want to present the background and expertise of our team members. This is crucial in building trust with potential clients. Skills and Experience: - W...
I am seeking a dedicated freelancer with relevant skills and experience in data entry to help me enter text data from multiple Excel spreadsheets. Here are the project specifics: - Data Source: The data needing entry is sourced from digital files, specifically Excel spreadsheets. - Data Type: The core of this task is the entry of text data. Ideal Experience and Skills: - Proficiency in Excel - High-speed typing - Accuracy and attention to detail - Confidentiality and trustworthiness Your responsibility will be to meticulously enter the text data from the given Excel files. As thoroughness and accuracy are key in this project, I would appreciate a freelancer who can guarantee this. Please bid if you feel fit for the project.
