Vb net projects computer hardware store punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
Software para embarcar hardware Wireless 5.8 GHz MIMO e SiSO, com chipset AR9344
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
need usd and oggfgsfdyioiuhytgfdsdfghjklkjhgfdsdfghjklkjhgvfcxzxcvbjkloi8765432qazxcvbhju76543wqazxcvbhju
need usd and oggfgsfdyioiuhytgfdsdfghjklkjhgfdsdfghjklkjhgvfcxzxcvbjkloi8765432qazxcvbhju76543wqazxcvbhju
I'm in need of a WPF form specialized in number validation, focusing primarily on calculation purposes. This project will feature: - Data input and validation: The functionality should allow the user to input various numerical data. Upon entry, this data should be automatically validated through programmatic checks to ensure the data's integrity and accur...calculations. The validated data will be used for calculation purposes. Therefore, the validation must be rigorous in checking for numerical inconsistencies. Ideal skills for this project include extensive experience in WPF form design and development, deep understanding of data validation (particularly with numerical data), and experience in developing systems used for calculations. Familiarity with .NET and C# would...
I am in need of a freelancer who manages a live Shopify store for a straightforward task. Your role will involve the installation of 2 specific apps on your Shopify store. Although there's no strict deadline for this project, I appreciate a dedicated and swift engagement. Qualified candidates should have: - A live Shopify store - Experience with app installations and assessments - The ability to provide thoughtful, structured feedback. Note: The specific functionalities and features I am seeking in these apps will be clarified as we proceed.
We are looking for an experienced webflow developer on a frequent hourly base for multiple projects. Please share webflow references. Thanks
We are seeking a certified solar designer with extensive experience in multi-family projects. The ideal candidate will possess comprehensive knowledge in solar design and related areas to effectively collaborate with various trades, including: 1. Structural Requirements/Roof Attachment: Proficiency in assessing structural needs for roof attachment of solar panels. 2. Space Allocation: Ability to identify alternative areas on the property for panel installation if roof space is insufficient. 3. Electrical Requirements: Understanding of electrical specifications relevant to solar installations. 4. Financial Modeling: Competence in developing financial models related to solar projects. 5. Utility Connections: Experience in coordinating with utility companies for seamless integr...
...service professional to handle various customer-related tasks. Key Responsibilities: - Answering customer inquiries through phone, chat, email, and text - Resolving customer complaints efficiently and professionally - Customer Account Set Up - Website Set Up & CRM - Providing detailed product information and support Ideal candidates for this position should have strong communication skills, good computer skills, great English/Spanish speaker/writer, be customer-oriented, and be capable of handling high volumes of customer inquiries. Experience in a similar role would be highly advantageous. Please note that this is a full-time position, and your availability to handle customer queries during business hours is essential. Base Salary of $750/mo + Estimated Monthly Commiss...
...artikel kami. Adapun syarat untuk bergabung sebagai berikut: Menyukai dunia tulis menulis terutama menulis artikel freelance. Menguasai kosakata dan aturan EYD yang baik serta benar. Teliti saat mengetik artikel. Mampu konsekuen dan bertanggung jawab dengan tugas atau job pekerjaan yang diberikan oleh Kami. Memiliki fasilitas penunjang yang memadai dalam dunia menulis online seperti: Laptop/computer, jaringan internet, email, HP untuk keperluan komunikasi dan kordinasi dengan team kami. Mampu menulis artikel dengan segala macam topik atau tema yang nanti diberikan oleh kami. Mampu menulis minimal 10 artikel, minimal 500 kata/artikel dalam 1 hari. Komunikatif, jujur, ulet, mau belajar menulis seo friendly dan harus 100% original ketika dicek di situs
As a Shopify store owner, I'm in need of a competent and experienced Shopify expert who can make specific code edits. I want to display the discounted price on multiple pages - product pages, collection pages, and the homepage. Key Requirements: - Display the discount price next to the original price on the aforementioned pages. - Ensure the discount is automatically applied without the need for a promo code. Ideal Skills and Experience: - Expertise in Shopify and liquid coding - Prior experience working on discount pricing and display - Excellent understanding of UX/UI to ensure a seamless display of discounted prices - Strong attention to detail to ensure accurate implementation across multiple pages Please reach out if you have the necessary skills and experience to hel...
App will be like: Platform: IOS and Android -> Hybrid solution is required Language: Flutter
...of a skilled PHP and Laravel developer to assist with creating a social media API and integrating it into my website. The main purpose of the API will be to facilitate the integration with various social media platforms, focusing on Meta, ads Facebook leads data stores in CRM systems and Whatsapp Api Key Responsibilities: - Develop a robust API with PHP - Implement the API into the website - Store API data accurately in a MySQL database Ideal Candidate: - Proficient in PHP and Laravel - Extensive experience in API creation - Prior experience integrating with social media platforms - Strong understanding of user authentication and profile handling in API development - Solid grasp of MySQL database implementation Please bid if you are confident in your ability to deliver on the...
...and 3D product digital videos tailored for social media, malls, and in-store activations. As a passionate filmmaker and storyteller, I lead a creative team specializing in bringing brands to life through compelling visual narratives. We're the founders and creative minds behind A Brand-First Branding Agency committed to delivering exceptional visual experiences for our global and regional clients and agencies. In today's digital landscape, brands are constantly seeking innovative ways to stand out and connect with their audience. With the growing influence of digital media across all platforms, there's a high demand for engaging visual content that resonates with viewers. Our clients frequently inquire about projects involving ATL and BTL campaigns, and we...
I am looking for a seasoned .NET developer with specialized expertise in API creation and .NET core framework to assist us in developing a brand new application. This project will require an innovative mind who has the ability to think creatively, solve problems and work efficiently. This is for a hospitality business. Key Responsibilities: - Develop new APIs and integrate with Frontend - Develop frontend UI with html, css, Javascript, bootstrap * Cart Functionalities * Order Creation * Menu * Order Placement Ideal Candidate: -Prior experience in creating applications using Entity Framework -Strong understanding and hands-on experience with MySQL -Demonstrable .NET development skills -Ability to work independently and deliver within deadlines.
As a sysadmin developer, I'm in need of an asterisk specialist to...asterisk specialist to build a Docker Compose script for an interactive vocal server. This project is multifaceted, carrying out outbound calls and saving responses in a database. Key responsibilities are: * Creation of an Interactive voice response (IVR) system. * Outbound calling function connected with my API for automated scheduling of phone calls. * MySQL database integration to securely store the recorded responses. For this assignment, it would be ideal if you have proficiency in using Asterisk, Docker Compose, API integration along with comprehensive database management skills It would be a cherry on top if you have prior experience constructing interactive vocal servers. Let's connect to dis...
Looking for someone who can add my affirm business account to my ecwid e-commerce store. I would like to have ecwid as an offer to all product page and at check out.
I'm looking for an experienced Python developer with knowledge in SAN switch health checks to write a script for automating my Cisco switch health checkup. The script will need to automate several tasks including: - Gathering output of overall switch health - Checking the conditions of each hardware status - send an automatic email via outlook I would like to see applicants demonstrate their experience in writing similar scripts, and especially in performing SAN switch health checks. Your familiarity with Python scripting and Cisco products will be vital for this project. Your application should reflect your past experience in the area. I am eager to see your detailed project proposals to assist in making an informed decision. Is this a task you can confidently deliver? Take ...
I'm in need of...help me with theme customization and website maintenance. Specific Tasks: - Customize a specific theme: I have a theme in mind that I'd like to use for my website. Your job would be to customize it to suit my brand and requirements. This may involve tweaking the layout, fonts, colors, and other design elements. Custom Functionality: - currently I am using woocommerce in my WordPress website. Store manager part is showing blank if I click on it. You just need to debug it and fix it. Ideal Skills: - Proficiency in WordPress theme customization - Experience with website maintenance - Proficient in PHP and custom WordPress plugin development If you have a strong portfolio in WordPress development, especially in theme customization and plugin development, ...
I am seeking a capable developer to create a vibrant, Google Play-like application for Android and the Web. Key features should include: • User Ratings and Reviews: Users should be able to rate and review apps within the interface. • Push Notifications: The system should have the ability to send push notifications to users. • In-app Purchases: The application should support in-app purchases for various services or items. The design should be vibrant and colorful, appealing to a wide range of users. The ideal freelancer for this job would have extensive experience in design-focused app development, UX/UI design, and implementing e-commerce within an app environment. Proficiency in Android and Web development is required.
I'm looking for a skilled EGYPTIAN web developer to create an online job portal for a university project. The site should include job listings and a resume upload ...seekers to apply for the listed positions. Ideal Skills and Experience: - Proficient in web development: Experience in developing web applications, specifically job portals, is highly preferred. - Frontend and Backend Development: Strong knowledge of both frontend and backend development technologies is required to build a functional and user-friendly website. - Database Management: Ability to store and manage user data and job listings in a secure and efficient manner. - User Experience (UX) Design: A good understanding of UX principles and design is crucial to ensure the website is intuitive and easy to navigate...
Creating a demo Android app for Sahel () with a simplified codebase while preserving the UI design. Here is the specification for building this stripped-down version. 1. Project Overview Objective: Develop a stripped-down demo version of Sahel app, maintaining its visual style but with simplified functionality. Platform: Android Programming Language: Java 2. Required Features and Pages Activities: Login Page: Input fields for username and password, a login button. OTP Page: Input for OTP, a verify button, simple OTP timeout display. Dashboard Page: Display basic user information, a logout button. 3. UI/UX Design Consistency: Maintain the look and feel of the original app using the same color schemes
I'm looking for a modern and minimalist logo that will be used mainly for store signage. The primary goal of the logo is to enhance the recognition of my brand. Store name is "Wise Buy Commercial" selling affordable clothings/garments. Key requirements: - Modern and minimalist design - High visual impact for store signage - Must enhance brand recognition Ideal Skills and Experience: - Proven track record in logo design, especially for physical locations - Strong understanding of modern design principles - Ability to create impactful, recognisable logos - Experience in designing for brand recognition *Attached is the existing logo that I want to be enhanced.
Read messages on WhatsApp, parse selected message for specific data and then update a website page with scraped information. This needs to be for Windows 11 and, if possible, quote also for apple apps (iPhone and iPad). Must include include piracy protection for windows and must be able to publish on apple store. It will have a free trial period (3 day at the moment). I do not expect more than 200 users max but they all know each other.
I'm in need of a professional who can install Google GA4 on my WooCommerce store and help me leverage it to improve my eCommerce sales. Although I have an existing Google Analytics account, I'm not familiar with GA4 compared to Universal Analytics, and could use some guidance and expertise in this area. Ideal skills and experience for the job include: - Proficient in Google Analytics and setting up GA4 for eCommerce. - Strong understanding of eCommerce sales tracking and optimization. - Excellent communication skills to explain the process and benefits to a beginner. Your expertise will be invaluable in ensuring that the installation is smooth and that I can extract the maximum benefit from GA4 to boost my online sales.
I'm looking for a professional to upload our produ...on Shopify, categorize them appropriately, and optimize the online store layout. Key Responsibilities: - Upload less than 100 products onto the Shopify platform - Classify products into existing categories and make necessary adjustments - Ensure products are correctly tagged and optimized for search engines - Optimize the online store layout for improved user experience and faster loading times Ideal Skills: - Proficiency in Shopify platform - Strong understanding of SEO and product categorization - Prior experience in product uploading and online store layout optimization - Ability to enhance user experience through layout design Please include examples of your previous work and how you would approach opti...
I'm seeking an expert .Net MAUI mobile app developer to help enhance our existing app with new features. The primary additions I require are a Doctor Appointment and Payment Gateway Integration, particularly with an emphasis on a modern and sleek design approach. Key Skills & Experience: - Proficiency in .Net MAUI - Proven experience with integrating appointment booking and payment gateways into mobile apps - Strong understanding of UX/UI and ability to deliver modern, sleek designs - Prior work on integrating mobile banking payment gateways preferred The ideal candidate will be able to not only add these features seamlessly into the existing app, but also ensure that the user experience remains intuitive and visually appealing. Your expertise will be key in making...
We are seeking a Microsoft Computer user from Malaysia to join our team. The ideal candidate will have extensive knowledge and experience in computer and be proficient in various Microsoft technologies. As a Microsoft Computer expert, you will be responsible for developing, testing. and debugging software applications, as well as providing technical support and troubleshooting assistance. The successful candidate must have strong problem-solving skills, attention to detail, and the ability to work independently or as part of a team. Skills required: - Strong proficiency in Microsoft applications - Expertise in computer programming and writing - Problem-solving skills - Attention to detail - Technical support - Troubleshooting This is a medium-sized project with ...
...in need of an Android app developer to help with an application that is intended for release. As the project owner, I'm keen to work with a professional who can bring my app to life and ensure that it's ready for the Google Play Store. Key Requirements: - Proficiency in Android app development: As an expert in Android development, you'll be able to translate my concept into a functional, user-friendly application. - Experience with app release: It would be beneficial if you have experience with the process of preparing and releasing an app on the Google Play Store. Please note that the main purpose of the app and the specific features are yet to be determined. I'm open to suggestions and would value your insights in these areas. If you think you...
I'm in need of an e-commerce website builder for my new online store. The website should be easy to navigate and have a visually appealing design. Key Features: - Shopping cart: I need customers to be able to add and remove items before checkout. - Payment gateway integration: I'd like a secure and reliable payment system that can handle multiple forms of payment. - User registration and login: The website should allow users to create an account, login, and securely manage their personal information. Product Categories: The store will have less than 10 product categories, each with an assortment of subcategories. Ideal Skills: - Experience in e-commerce website development - Proficiency in website design - Strong knowledge of payment gateway integration - A good...
I'm in search of an influencer affiliate specialize...specialized in the health and wellness niche. The purpose is to drive sales for my ecommerce store that focuses on health products. Key Responsibilities: - Drive direct sales through engaging content Desired Skills and Experience: - Proven experience as an influencer in the health and wellness domain - Ability to drive traffic and conversion - Excellent communication skills - High engagement rate - Established follower base with a knack for health-related content and for the affiliate program he/she will be paid be each sale he/she gets for 20% to30% of the product price If you believe you can meet these objectives, place your bid. Illustrate your experience and explain how you can help my store drive sales ...
The goal of this project is using Vivado tools to enable a hardware implementation on an FPGA board. The key requirement from the FPGA board is high computational speed. Therefore, proficiency in Verilog language is preferred as I intend to implement the NTT algorithm. I am looking for a developer who is experienced with FPGA boards and Vivado tools. The chosen freelancer should also have the ability to maximize computing capabilities of the board for the said implementation.
I'm in need of an experienced web designer who can create an engaging and functional UI design for an online mall store. The project should encompass: • A introducing an enticing e-commerce platform. • Integration of a Customer Review System. Please note, the development portion of the customer review system should ideally be carried out using Python. Ideal candidate should carry: • Skilled proficiency in UI/UX design • Strong competence in Python • Previous experience with e-commerce platforms highly preferred. End result should be a user-friendly and aesthetic shopping platform with seamless reviews functionality. Yours sincerely.
I need a backend api (or program) that running on java or .net that can send messages via facebook messenger (do not use Facebook APIs) using Selenium or other automation frameworks you are familiar with (if you use other automation frameworks, you must notify me for confirmation). Key features: 1. Log in with the provided the user/password. 2. Send messages to specific Facebook users with provided information. 3. Send Messages from more than 2 senders to specified receiver in a short time. 4. Receive messages from Facebook users in real time (can get username information, message content). 5. Facebook will not block messages for spam reasons (the limitation is defined by you).
I'm currently running a UAC campaign that's delivering a CTR below 1%. It's targeting Google Search, YouTube, and Google Play Store with the primary goal of increasing app installations. I need a highly skilled and experienced professional who can help in optimizing and improving the CTR of the campaign. Key Requirements: - Proven experience with UAC campaigns on Google Search, YouTube, and Google Play Store - Expertise in increasing CTRs, especially for app installations - Ability to analyze campaign performance and implement targeted enhancements - Proven track record of driving successful UAC campaigns - Strong understanding of Google Ads and best practices for UAC campaigns If you have the necessary skills and experience, I'd like to hear from you. ...
I'm currently running a UAC campaign that's delivering a CTR below 1%. It's targeting Google Search, YouTube, and Google Play Store with the primary goal of increasing app installations. I need a highly skilled and experienced professional who can help in optimizing and improving the CTR of the campaign. Key Requirements: - Proven experience with UAC campaigns on Google Search, YouTube, and Google Play Store - Expertise in increasing CTRs, especially for app installations - Ability to analyze campaign performance and implement targeted enhancements - Proven track record of driving successful UAC campaigns - Strong understanding of Google Ads and best practices for UAC campaigns If you have the necessary skills and experience, I'd like to hear from you. ...
I'm in need of a professional who can install Google GA4 on my WooCommerce store and help me leverage it to improve my eCommerce sales. Although I have an existing Google Analytics account, I'm not familiar with GA4 compared to Universal Analytics, and could use some guidance and expertise in this area. Ideal skills and experience for the job include: - Proficient in Google Analytics and setting up GA4 for eCommerce. - Strong understanding of eCommerce sales tracking and optimization. - Excellent communication skills to explain the process and benefits to a beginner. Your expertise will be invaluable in ensuring that the installation is smooth and that I can extract the maximum benefit from GA4 to boost my online sales.
I'm looking for a skilled designer to create photorealistic images of a hardware device for marketing and investor presentation purposes. Key Requirements: - The images should showcase the device's functionality and operation, while also highlighting its design and aesthetics. - The preferred style for the images is photorealistic, to provide a clear and tangible representation of the product. The ideal freelancer for this project should have: - Proven experience in creating photorealistic images for hardware devices. - A strong eye for design and aesthetics, capable of highlighting key features in a visually appealing way. - The ability to understand the technical aspects of the device and translate them into compelling visuals. The goal of this project is to...
...including push notifications and seamless synchronization with the web version. Admin Panel: `Comprehensive admin dashboard for managing products, orders, users, and employees `Employee management system with roles and permissions `Sales analytics and reporting tools `Content management system (CMS) for updating website content `POS Integration: Integrate a Point of Sale (POS) system to facilitate in-store transactions and synchronize inventory across online and offline channels. Skills Required: ~Proficiency in web development languages (HTML5, CSS3, JavaScript) ~Experience with front-end frameworks (React, Angular, Vue.js) ~Back-end development skills using Node.js, Python, or PHP ~Mobile app development expertise (Android Studio, Swift, Kotlin) ~Database management (MySQL,...
...set up an online shop that sells electronics primarily to an adult audience. In absence of specific features mentioned, the standard functionalities of a good e-commerce site are expected. Key Tasks: -I need a B2B online store with a maximum of 100 products. It does not need a payment method at checkout. The only thing that is important is two emails with the order confirmation via PDF or email to me and one for the partner at the end and checkout. With a list of the quantities and the item number and position and RRP. That's all there is to it. Graphically, the store can be minimalistic. Without much graphic effort. It is simply important that my partners have a place where they can place an order electronically. And that's it. I then make the transfer to the...
I'm in need of a talented web builder with experience in Shopify and modern designs. I have a vision for my online store and I need a professional that can bring it to life. Here are the specifics of what I am looking for: - Design: Your expertise in modern web design is crucial for this project, as I'm looking for a clean and sleek aesthetic that's visually engaging. - Payment Gateway: Experience with Stripe integration is needed, as it will be our primary method of receiving payments. - Features: There are some key features I want to incorporate into my store. I need inventory management capacities to help keep track of my product stock. In addition, the design feature is critical. This involves creating a visually pleasing and easy-to-navigate user inter...