Vb net random file processing punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I am in need of an Android application that will enable customers to design their garage floor usi...floor using our tiles. The app should allow users to: - Design their floor online - Email their design requests - Place orders through the app The garage floor tiles come in one size and are available in a variety of 12 colors. Additionally, we offer straight and corner edgings that can be incorporated into the design. It is crucial that the app integrates seamlessly with Shopify for order processing. The ideal freelancer for this project should have relevant experience in creating e-commerce applications, particularly those that involve customization. Experience in integrating applications with Shopify is also highly desirable. Please provide examples of your past work in your ap...
I need a tool that will help me process a large amount of images by cropping them automatically to a landscape format. Project UI Link: Key Features: ...Link: Key Features: - Image formats supported: JPEG, PNG - Output dimensions: landscape (width > height) - Automatic detection and cropping of the main subject of the image is preferable or that can be selected as need. Ideal Freelancer: - Proficient in image processing and recognition - Experience with automation scripts - Strong background in image data manipulation - Familiarity with JPEG and PNG file formats. If you have the skills and experience necessary to develop such a tool, please get in touch.
Google Analytics 4 migration and Tag Manager Set up...Google Ads pixels. - Audit of essential conversion measurement pixels. - Audit Measurement in the relationship with the consent management tool/cookie banner/CMP. Incorporation of a CMP. Cost of the CMP by the client. - Audit and Set up in GA4 and GTM of measurement coordination with the CMP. - Set up of "Consent Mode" in GA4, a mechanism to comply with legal regulations and Google Analytics processing requirements. - Set up Enhanced Conversions. Review of requirements and submission of Data Layer requirements to the client's Development team for implementation. Validation and final set up I'm primarily interested in enhancing accuracy and performance, so I'll appreciate someone with a proven record ...
I'm looking for an expert developer who's proficient with AWS services, particularly EventBridge, and has experience integrating with Shopify webhooks. Key requirements: - Setting up and pushing code into fresh AWS servers - Creating and configuring AWS EventBridge to handle large volume webhook eve...especially EventBridge - Experience with Shopify webhooks - Knowledge of server setup and configuration - Prior experience with middleware systems and large volume event handling - shopify graphql and restful api Please note that while the user hasn't specifically outlined the action to be taken upon receiving the webhooks, it's expected that you'll be able to advise on the optimal setup for further processing of these events. Please note: currently, I using...
Overview: This application will enable Shopify store owners to collect and display customer reviews. However, only customers who have made a purchase will be able to leave a review. You can use the reviews app that Shopify provides as a ://gith...should be no public option for writing a review on the store’s frontend. Review Collection: • After a purchase, customers should receive an invitation via email to write a review. Review Display: • Reviews submitted by customers should be displayed on the respective product page of the Shopify store. Webservice Integration: • All reviews must be sent to an external webservice for additional processing or storage. Subscription Plans: • The application should support different subscription plans (e.g., Free, ...
I need a comprehensive and professional formatting of a government project report. This report is aimed at analyzing the effectiveness of current government programs, identifying areas for further improvements and suggesting recommendations for future initiatives. The needed formatting requirements include: - Font style and size - Heading styles - Margins and spacing - Including images, tables etc. Ideally, you possess a keen eye for detail and an understanding of government report structures. A background in preparing and formatting formal documents or reports is a plus. The project has to be completed ASAP, so time management skills are crucial. Please bid, outlining your relevant skills and estimated turnaround time.
I browse to a text file containing a definition of a flowchart e.g. the intended flowchart is attached file It creates an image file of the flowchart. Simple example: See attached file The text file has 3 lines as follows: 1 circle 1.5 5.3,1.2 Begin 2 rectangle 6,2 5.3,2.5 Find node that represents the itemset 3 line 1,2 This file would mean to: 1: Draw a circle with radius 1.5 at point (5.3 across,1.2 down) with the word "Begin" in it. 2: Draw a rectangle with width 6 and height 2 at point (5.3 across,1.5 down) with the words "Find node that represents the itemset" in it. 3: Draw a line pointing from 1 to 2 I don't care how the definition works other than how general it is. The above is just to show what I mean. 1....
I am looking for an expert...in AI, specifically with fine-tuning experience in Convolutional Neural Networks (CNN). My primary focus is on improving the accuracy of specific tasks in the field of Natural Language Processing (NLP). Key tasks for this project include: - Evaluate the current performance of the CNN on specific tasks - Implement fine-tuning protocols to enhance accuracy - Validate and optimize the model for our specific dataset Ideal freelancer must have: - Extensive knowledge and experience in Artificial Intelligence - Proficient with Convolutional Neural Networks - A strong understanding of Natural Language Processing - Proven track record with AI fine-tuning. Your core responsibility will be to adapt our current AI model to enhance its task accuracy in an...
I'm seeking an experienced WordPress developer to craft an e-commerce website primarily using Easy Digital Downloads. Here's what I'm looking for: - Create an intuitive and seamless e-commerce experience. - Integrate Easy Digital Downloads as the core marketplace plugin. - Set up multiple Indian payment gateways, such as Net Banking, BHIM, GPay, and Phone Pay, ensuring security and ease of use. - Optimize site for performance, scalability, and SEO. Ideal Skills: - Proficiency in WordPress & Easy Digital Downloads - Experience with payment gateway integration - Strong portfolio with e-commerce examples - SEO and performance optimization expertise The successful freelancer will demonstrate a strong understanding of e-commerce strategies, particularly within the W...
...and do version control RESPONSIBILITIES: - Integration of new B2B APIs - New payment gateway integration - - Implementation of bug fixes and performance improvements. - Regular software updates and security patches. - Feature additions and enhancements. Skills and Experience: - Proven experience in maintaining e-commerce solutions. - Ability to work independently and meet deadlines. - .NET and are a plus but not a requirement. Prerequisites: For the long term project the *STARTING* wage will be as stated below. 1) Accept initial hourly rate of U$5.00 2) If awarded, accept and start work IMMEDIATELY 3) Have MINIMUM OF 20+ hours a week for long term ongoing support and development. 4) Work hours: predominantly 20:00 to 02:00 (UTC -3 Brazil TIME) 5) Be available to work on wee...
...Fields: Create all necessary form fields as outlined in the Word document, including text fields, dropdowns, checkboxes, addable rows table, etc. - User-Friendly Interface: Design a clean, user-friendly interface. Skills Required: - Proficiency in HTML, CSS, JavaScript, and responsive web design - Experience with web form development and validation PHP Integration (optional): - Form Data Processing: Develop a PHP script to receive the form submission and convert the data into a multidimensional array. - Data Population: Implement functionality to pre-fill the form fields with corresponding data from the multidimensional array when the form is displayed again. Deliverables: - one (1) fully functional and responsive webpage form based on the provided Microsoft Word document -...
I am seeking expertise in deploying the Mistral system on-premises, specifically for data processing tasks. Key Project Elements: 1. Mistral System Installation: Implementing Mistral system in our on-premises hardware setup, ensuring optimal performance and security. 2. Data Processing: The system should be set up to efficiently process unstructured data such as texts and emails. Ideal Candidate: - Expertise in on-premises Mistral system deployment by using NVIDIA GPUs - Profound understanding of data processing techniques for unstructured data - Previous experience in similar projects would be preferred.
We are looking for a computer program that can take over some of the repetitive tasks we currently ... The program will primarily be used on Windows OS and should be capable of performing the following functions: - Automating data entry tasks - Organizing files efficiently - Managing emails effectively - Checking invoices to prevent double billing Ideal candidates for this project should have: - Experience in developing Windows-based automation software - A strong understanding of data entry, file organization, email management, and invoice checking processes - Proficiency in designing user-friendly interfaces - Ability to integrate error prevention mechanisms to ensure accuracy Your solution should help us streamline our work processes, reduce human error, and increase overall e...
...tasks: integrating e-commerce functionality and creating a custom, modern, minimalist theme. Key Deliverables: - E-commerce Integration: This will involve setting up a seamless online shopping experience for customers. The ideal candidate will be adept at integrating popular e-commerce plugins like WooCommerce or Shopify, ensuring easy product browsing, cart management, and secure payment processing. - Custom Theme Development: The website's design should be tailored to fit a modern and minimalist style. The selected freelancer should be capable of creating a unique, visually appealing theme that reflects this aesthetic. Given that the main purpose of this website is to display information and a portfolio, the design should be clean, uncluttered, and user-friendly. ...
...Building: -Engage with followers and respond to comments and messages. -Organize and manage giveaways for followers Research and Analysis: -Conduct research on digital beauty trends and skincare ingredients. -Monitor and report on social media analytics to measure the impact and adjust strategies accordingly. -Shopify Management: -Update and manage product listings on Shopify. -Assist with order processing and customer inquiries. Requirements: -Proven experience as a Virtual Assistant or relevant role. -Proficiency in using ChatGPT for content creation and customer engagement. -Strong knowledge of Shopify and its functionalities. -Excellent research skills and the ability to stay up-to-date with industry trends. -Exceptional copywriting skills with a keen eye for detail. -Stron...
I'm looking for a Turkish...- Proficiency in Turkish language, both written and spoken, with a strong understanding of the nuances and idiomatic expressions used by teenagers - Prior experience in localizing or adapting content for language learning purposes - Understanding of game mechanics and how language affects player immersion Key responsibilities will include: - Reviewing and revising the existing Turkish language file in the game - Enhancing the phrases and sentences to be more natural and appealing for teenagers - Ensuring that the language used is suitable for written dialogues or subtitles within the game, to aid language learning The successful candidate will play a vital role in improving the language learning experience for players while helping them progress th...
I'm in need of a freelancer proficient in Microsoft Word and graphic design to inject a PNG image as the background of a Word document. Key Tasks: - Insert PNG into a Word file, ensuring it is spread across the entire page as a background - This PNG needs to be present on all pages of the document to enhance the aesthetic uniformity - The output should generate a consistent branded document, improving its visual representation Ideal Skills: - Proficient in Microsoft Word - Proven graphic design experience - Attention to detail - Understanding of visual brand aesthetics For the winning bidder, attention to detail, punctuality, and excellence play a critical role in this project's successful execution. Please submit bids with relevant experience and proposed timelines.
...The freelancer should create functionality for users to customize sales offers by selecting and modifying purchase conditions, adjusting margins, and generating offer views exportable to Excel. Order Recording: Develop a user-friendly interface for recording orders by selecting sales and purchase offer IDs, entering customer-requested details, and generating informative tables for efficient processing. Inquiry: Enable users to upload customer lists for comparison with purchase prices, configure margins, and calculate selling prices directly. The module should support export to Excel for convenience. Purchase Analysis: Implement functionality for analyzing purchase invoices by uploading them with EAN, description, units, and prices. The app should provide detailed transac...
I'm in need of a talented software developer to create a self-ordering kiosk software. This is an urgent requirement and I'd like the project completed as soon as possible. Key Software Features: - Menu Customization: The software needs to enable users to browse through a customized menu and make their selection. - Payment Processing: The software should integrate secure and efficient payment processing features, accepting multiple payment formats. - Order Tracking: Users must be able to track their orders in real-time through the kiosk software. While no particular operating system compatibility was specified, universal compatibility would be preferred. Past experience in developing similar kiosk software would be a significant advantage. A developer with an acu...
...looking for an experienced developer to assist me with an Artificial Intelligence (AI) driven video processing project. The key points of this project are: - **Objective**: The main aim of this project is to create a video processing system that could understand video content and generate a talking video avatar. - **Tasks**: The AI system should be capable of performing three key tasks: facial recognition, text extraction, and converting the extracted text + video into a talking video avatar. - **Output Format**: The desired output format for the generated talking video avatar is MP4. Ideal candidates should have: - Proven experience in artificial intelligence, particularly in video processing and generation of talking video avatars. - Proficiency in facial reco...
I'm looking for a talented mobile app developer, well-versed in Flutter, to create a cross-platform application. Here are the key aspects of the project: - Compatibility: The mobile app should be compatible with both iOS and Android platforms. - Primary Function: The primary function of the app will be OCR (Optical Character Recognition). This means the app should be able to recognize and e... Ideal skills and experience for this job would include: - Proficiency in Flutter for mobile app development - Prior experience with OCR integration in applications - Strong understanding of both iOS and Android platform-specific requirements - Capability to design and develop user-friendly and visually appealing mobile applications - Ability to efficiently utilize device's camera for imag...
I'm currently working on a Premier Pro project, but I'm experiencing video glitches in the form of unwanted artefacts that need to be fixed. Therefore, need an expert video editor, proficient with Premier pro, who can help me eliminate these glitches swiftly. Ideal skills include: - Proficiency in Adobe Premier Pro - Ex...eradicating unwanted artifacts - Excellent problem-solving skills that will ensure efficient resolution of the issue. I was told by Adobe Help that it was third party fonts, and GPU capability causing the issues, but I have deleted the fonts, and used a more powerful computer, still with the same issues and warnings coming up. I have since removed effects that were needing the more powerful processing, but still getting the ribbons and warnings? Pl...
We're looking for a seasoned backend developer adept at working with the platform. Our project primarily involves rectifying some issues and implementing standout features. The scope of work includes: - Implementing a seamless payment processing system. - Addressing some undisclosed issues. - Incorporating a solid user authentication system. - Optimizing the platform's performance. Prospective freelancers should possess proven experience in backend development, with solid understanding of different programming languages. Practical exposure to database management or mobile app development would be a plus, but is not a mandatory requirement. Prior experience with platform is a necessity. A prompt turnaround time and structured approach to problem-solving would be highly...
I'm seeking an experienced Android Developer to help me resolve some critical bugs in my Electric Vehicle Charging app. Key Requirements: - Fixing the app crashes: Currently, users are experiencing crashes randomly during the initiation of a charging session. This is a critical problem that needs a quick and effective solution. - Addressing payment processing issues: There are some ongoing problems with the payment processing system within the app. Users are facing difficulties in completing transactions. Ideal Skills and Experience: - Proven experience in Android app development, particularly in addressing app crashes and payment gateway issues. - Good understanding of the charging session initiation process and associated technical challenges. - Strong problem-solvin...
...Fields: Create all necessary form fields as outlined in the Word document, including text fields, dropdowns, checkboxes, addable rows table, etc. - User-Friendly Interface: Design a clean, user-friendly interface. Skills Required: - Proficiency in HTML, CSS, JavaScript, and responsive web design - Experience with web form development and validation PHP Integration (optional): - Form Data Processing: Develop a PHP script to receive the form submission and convert the data into a multidimensional array. - Data Population: Implement functionality to pre-fill the form fields with corresponding data from the multidimensional array when the form is displayed again. Deliverables: - one (1) fully functional and responsive webpage form based on the provided Microsoft Word document -...
I'm looking for help with a professional writing for a business loan application forms to fill in and send back to me. Key requirements: -fill in the question and write a user-friendly loan application form for high success rate. - there are 2 forms to fill in 1- Business plan template 2- cash flow template, they are in Microsoft excell file, once filled in just save and return to me so it is ready for the application upload. Ideal freelancer will have: - Proven experience in English literature - Strong understanding of business planning and growth. The application form is an essential part of the loan application process, with few questions which asks how the business growth and planning , once is written I can review for the final outcome. ,If you have the right s...
I'm seeking an individual with excellent typing skills to convert a text-only PDF file into a Word document. The content is not complex; it consists of plain text without images or tables. Key Requirements: - Complete the task within 3-5 days - Ensure the content is accurately typed - Deliver the Word document in a standard text format Ideal skills: - Proficient in typing and data entry - Familiar with Word processing software - Attention to detail in maintaining accuracy - Ability to meet deadlines
I require a well-designed Shopify store to sell my range of physical products. The website should offer a seamless and user-friendly experience to convert visitors into customers effectively. Key project requirements: - Configure and integrate an e-commerce platform into the website - Design features for showcasing more than 50 different types of products - Implement efficient transaction processing and secure payment gateway systems Ideal skills and experience: - Extensive experience in building and designing Shopify websites - Excellent understanding of e-commerce platforms - Strong track record of working on similar projects.
...administrators. • Interface to view, update, and manage user submissions and their statuses. • Whats App Chat Integration: • Interface for WhatsApp chat widget for customer support. • Accessible on all relevant pages. Backend Development 1. Authentication: • Implement secure user authentication using JWT (JSON Web Tokens) or OAuth. • User registration, login, and password management. 2. Payment Processing: • Integrate with a payment gateway (e.g., Stripe, PayPal). • Implement APIs to handle payment transactions, process payments, and manage payment statuses. 3. Document Management: • API for users to upload documents. • Secure storage of documents. • API for admins to update the status of submissions. 4. WhatsApp Integration:...
I'm seeking a professional who can conduct a series of payment tests on our website. We are currently integrated with payment gateway but are specifically interested in Korea. Key tasks include: - Tes...gateway but are specifically interested in Korea. Key tasks include: - Testing successful payment transactions with Nuvei - Testing refund transactions Ideal candidates should have: - Proven expertise with Nuvei payment gateway - Strong knowledge of Korean payment infrastructure - Experience in conducting payment gateway tests - Proficient understanding of e-commerce platforms and transaction processing - Comfortable with using card to do payments Your thorough and meticulous approach can help us ensure seamless and error-free payment processes for our Korean users. We wi...
I need assistance with an AI project that focuses on Natural Language Processing (NLP). The crux of the project is Sentiment Analysis and therefore, I am in search of a proficient AI specialist with a strong background in this area. Key Skills & Experience: • native places people • 3 month projects. • Ability to work under deadlines while ensuring accuracy. • Strong problem-solving skills in AI-related issues. Your role: • Assisting with the design of an effective sentiment analysis tool. • Fine-tuning results for accuracy. • Assisting with potential issue troubleshooting and resolution. I expect the finished project to be well-designed, efficient and accurate in its readability and interpretation of sentiment from textual data.
...of changes to my existing web application. The application is built on .NET, C#, MVC and MSSQL. The main areas of focus are: - **Database modification(If need)**: - **Adding New Features(If Need)**: I'm looking to integrate some new features into the web application as per requirement. - **Front-End Modifications**: I need some enhancements on the front-end, focusing on design/UI changes as per requirement. Additionally, the project would also involve: - **Back-End Modifications**: These would be required to ensure the new features are implemented effectively. - **Bug Fixes**: Any existing issues within the application should be identified and rectified. The ideal candidate should have extensive experience in .NET, C#, MVC and MSSQL. Additionally, they should ha...
I'm in need of a skilled Laravel developer to create a QR scanner-enabled webpage. This webpage should be capable of updating a database based on the scanned QR code information. I'm not entirely sure whether an existing database can be used for this project, so your experi...handle multiple scans of the same QR code by the same user by ignoring subsequent scans - The primary action the system should take is a check-in/check-out registration process, triggered by the QR scan Ideal skills and experience for the job: - Proficiency in Laravel and PHP - Experience with database setup, management and integration with web applications - Knowledge of QR code integration and processing in web applications - Ability to make decisions on how to handle multiple scans of the same ...
I'm looking for an expert to help configure my Cyclecloud HPC cluster. This is a specific project with the following requirements: - Configuring the cluster for machine learning and simulations tasks - Ensuring the cluster can handle large data processing in a timely manner - Implementing efficient resource utilization strategies - Validating the performance of the cluster with real-world workloads The ideal candidate for this role should have: - Proven experience in configuring Cyclecloud HPC clusters - A strong understanding of machine learning and simulation requirements - The ability to optimize resource utilization and improve scalability - Excellent communication and problem-solving skills read the specs: What I would like to do is to set up a Cyclecloud cluster w...
I need a freelancer to convert a series of simple, text-based PDF documents into Word. Your job is to ensure that the text in the Word documents is fully editable, and that the original formatting is preserved. Key Responsibilities: - Convert multiple text-based PDF documents into fully editable Word documents. - Ensure the text is accurately extracted and maintained, without any errors or omissions. - Preserve the original formatting of the documents in the Word version. Ideal Candidate: - Proven experience in PDF to Word conversion, especially with multiple documents. - Proficient in software for text extraction and formatting preservation. - Attention to detail and ability to meet deadlines. Please note that the documents are text-only, so no experience with image or table conversi...
I require assistance in viewing and downloading a few specific files from a different computer. Key Details: - The files that need to be accessed and downloaded are primarily documents and payment transfer proofs. - The method of access and download should be via a secure file transfer service. - Security is important. Therefore, the transfer should be password protected. Ideal Skills and Experience: - Proficiency in using remote file access and download tools. - Understanding of secure file transfer methods and experience with password protection. - Keen attention to detail, ensuring that the right files are identified and downloaded. (Images is for illustration purpose only) Name of real recipient will be told.
...showcases, before and after photos, and customer testimonials. The calendar should be designed for posts 2-3 times a week in a mix of reels and posts. The grid calendar should show a sample photos of what the post/reel cover should look like and a theme fot the post. The stories should be general ideas for daily stories (5 days per week) - Implement a balance between thematic content planning and random content. I am open to a mix of both approaches if you believe this will help improve our engagement. Skills and Experience: - Prior experience managing Instagram accounts for similar businesses, particularly in the automotive or services sector. - Proven track record of creating engaging content that leads to increased follower engagement and, ideally, conversion. - Knowledge of ...
I urgently need an Excel whiz capable of converting Word documents, PDF files, and other document files into Excel, as soon as possible. There are no specific formatting requisites for the Excel files post-conversion. Ideal Skills: - Proficiency in Word, PDF, and other file formats - Excellent Excel skills, with ability to handle any type of conversion - High attention to detail - Strong commitment to speed and accuracy - Readily available for immediate start Experience in similar rapid file conversion projects will be highly advantageous. Plese ensure you can fulfil the requirement for immediate turnaround before placing your bid.
I'm seeking a freelancer photographer in Danang, specializing in portrait photography with focus on generating stunning studio or on-location portrait shots. In addition, post-processing of photos will be required. Key Responsibilities: • Capturing high-quality portrait photographs • Executing post-process editing to enhance images where necessary Expected Skills: • Extensive experience in portrait photography • Proven expertise in photo editing software • A strong portfolio of work demonstrating a keen eye for detail Please include samples of your previous work in your proposal, especially those related to portrait photography.
I'm needing a skilled Wix developer to build a membership website for our association. This project encompasses numerous features: - Member Registration: Design an accessible registration process for new members. - Payment Processing: Implement a seamless and secure system for processing recurring membership subscriptions. - Member Login & Account Management: Enable members to login using their email and password in order to manage their own account details. Prior experience in executing similar projects and knowledge in payment gateways is preferred. The website should be user-friendly, guaranteeing our members a smooth and intuitive experience. Your expertise in building Wix websites will be instrumental to the successful completion of this project.
...and developing a strategy to acquire clients. The ideal candidate should have: - Experience in business consultancy, particularly in setting up new businesses. - Knowledge of legal and financial business structure requirements. - Proven strategies for client acquisition and marketing, especially for freelance or B2B services. - Ability to provide personalized advice for a startup in the data processing domain. The project will involve: - Assessing the best business structure for my services (Sole Proprietorship, LLC, etc.). - Guiding through the necessary legal and financial setup procedures. - Developing a clear and actionable client acquisition strategy. - Creating a marketing plan tailored to my services. The end goal is to have a solid foundation for my business and a cle...
I require a freelancer with excellent Word processing skills and a solid understanding of professional resume layouts. You'll be tasked with formatting a resume from a PDF into a Word document. Here are the key project requirements: - Format the resume in Word maintaining a clean, professional layout The word Doc is the content I want it to be. The PDF is how I want it formatted. As the files have my personal information I don't want to attach them just yet. The documents are only one page
...build an OCR system that will be primarily used for document processing. The system should be able to process various types of documents including printed documents, handwritten notes, and scanned images. Key requirements for the project include: - Develop the system using Python, Java, and C# - Ensure that the system can accurately extract and process text from different types of documents - Implement a reliable method for processing printed documents, handwritten notes, and scanned images - Provide a user-friendly interface for uploading and retrieving documents Ideal candidates for this project should have: - Proven experience in developing OCR systems - Expertise in Python, Java, and C# - Strong understanding of document processing techniques - The ability to...
I'm looking to build a un...for the appointment feature. Key Requirements: - Design and Development: The ideal candidate should have experience in creating ecommerce sites with integrated booking systems. A clean, modern design is essential. - Ecommerce Functionality: The site will need to support the sale of physical products as well as services. - Payment Gateway: A secure, reliable payment gateway is necessary for processing online transactions. - Appointment Booking System: A user-friendly, integrated booking system will be required for scheduling appointments. - Website Usability: The site should be easy to navigate and use, with clear calls to action for both purchasing products and booking appointments. Feel free to reach out if you have any questions or need further...
I need a Python developer to help me convert a PDF file into an XML file. And Share that Python Code With me as well. Key Requirements: - The primary task is to extract text from the PDF and structure it into an XML file. Ideal Skills: - Strong proficiency in Python, with a good understanding of its syntax and libraries, particularly for PDF processing. - Experience in text extraction from PDFs is a plus. Please note that I do not have a predefined XML structure in mind, so I'll need some guidance on how to structure the output.
I have a PDF file that I need converted into a Word document. The purpose of this conversion is to enable editing of the contents within the file. The layout of the PDF file is quite complex as it contains various images and tables. I would appreciate if the Word document could be formatted in a standard business format. Ideal Candidate: - Proficient in converting PDFs to Word - Experience with complex layout conversions - Attention to detail in formatting - Understanding of standard business formatting