Vb.net jobs aruba punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
srtfsjnfgjfyjtjnhtjnghnttfgfgyhesrtgegsrghrryrthnrdtghrtghsrwtfmu5uj54etyqa3rtw3jn535tnq35r4e5yw4tyw3jn6n67ytb3erq3brtnjwtw4et5tws54m6tws4tws34et64ye4
srtfsjnfgjfyjtjnhtjnghnttfgfgyhesrtgegsrghrryrthnrdtghrtghsrwtfmu5uj54etyqa3rtw3jn535tnq35r4e5yw4tyw3jn6n67ytb3erq3brtnjwtw4et5tws54m6tws4tws34et64ye4
plz teach me how to do these online jobs contact me 0713578888 kjlfgfdigjlfjglkjdflgj gfjgdfugoijfdjg dfgfdoiguodugjdfg gfgjfdjgljfdgkl fglfjgifdgjlfdjgfdjgjdfuglujdf gfdgfdgljfdlg gjfdlgjlkdfkjg fg gfogufdlgjlfd fiuglfdjglk gfgjoiijgjf fjgiljdflkgjdfgjdflkjglkfdkjgoigtutglfdjgldfgjttg gfgolidfugghljglfjdgufogfjgfjlkgfjklgjfd gflkjgfkldjglkfddjgioglfd g gfgos glfdkgj fgjglfdjglfd flgdfiofuglkfdjgjlf fdlfdjglksdfjgskdjglksfdjg fkgjfdlkgjlfg fgjoiugdfjglkjfdlgjldfjg
hello sir kmknknjnjnjnjhbhjbjbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb
I'm in search of a skilled .Net mobile developer to finalize my .Net Maui mobile application. The key tasks include: - Implementing the logic, specifically around user interface interactions. - Although user authentication, data synchronization, and push notifications were not explicitly mentioned, familiarity with these aspects would be advantageous for potential troubleshooting or further development. The mobile application is already well underway, with views, and a nearly finalized backend. Therefore, I need a freelancer who is proficient in both .Net and Maui and can confidently complete the application. Ideal skills and experience: - Proficiency in .Net and Maui - Experience in mobile application development - Understanding of user interface intera...
I'm in need of a talented After Effects expert who can handle my project on a very urgent basis. The job entails tasks in both visual effects and motion graphics, requiring exce...to enhance the visual appeal of the content, ensuring it's engaging and high-quality. - Crafting engaging motion graphics: The task includes creating dynamic and appealing animations that complement the content. Ideal Candidate: - Proficient in After Effects: It's crucial that you have substantial experience and expertise in this software. - Skilled in visual effects and motion graphics: Prior jobs or a strong portfolio in these areas would be highly beneficial. - Ability to work under pressure: Given the urgent timeline for the project, you should be able to handle stress and deliver high-...
...performance improvements. - Regular software updates and security patches. - Feature additions and enhancements. Skills and Experience: - Proven experience in maintaining e-commerce solutions. - Proficiency in React, Node.js, Python, and MySQL. - Strong problem-solving skills. - Excellent understanding of software best practices and design patterns. - Ability to work independently and meet deadlines. - .NET and are a plus but not a requirement. Prerequisites: For the long term project the *STARTING* wage will be as stated below. 1) Accept initial hourly rate of U$5.00 2) If awarded, accept and start work IMMEDIATELY 3) Have MINIMUM OF 20+ hours a week for long term ongoing support and development. 4) Work hours: predominantly 20:00 to 02:00 (UTC -3 Brazil TIME) 5) Be availabl...
The ideal applicant will have a significant amount of experience working in the educational sector, with a special emphasis on dealing with material that is written specifically in Chinese. Additionally, the applicant is required to de...a daily commitment of three to five hours, the time period that is anticipated to be required to do this activity is around one to two weeks. The speed has to be moderate and should make it possible to do anything on time. I was wondering how many projects you have finished. Could you please tell me about your previous experience working as a translator and whether or not you are available for jobs of varied lengths? I would appreciate it if you could tell me about your experiences with your prior employment, whether they include pleasant or bad e...
I am in search of a skilled .NET Core developer to work on a project for me. As the client, I'm looking for someone who can bring the following to the table: - Proficiency in .NET Core: Given that my project is based on this technology, familiarity and experience with it is a must. - Application Development Experience: Previous experience in developing web applications would be particularly beneficial. - Strong Problem-Solving Skills: The ability to troubleshoot issues and devise solutions is key. - Attention to Detail: It's important that our project is implemented correctly and accurately. The ideal candidate for this project would be someone who understands the nuances of .NET Core, has a good track record in application development, and can work efficie...
...Everyone will see the photos they have permission to. He will be able to filter and sort them on a basic basis - Photographer rating system System users: - Broker ◦ Establishes a request for a photo shoot ◦ Selects the date and service ◦ Sees his orders including the resulting photos ◦ Evaluates - Photographer ◦ Sees assigned jobs with a schedule (calendar) of jobs ◦ Confirms the job ◦ Inserts the resulting photos ◦ Sees your historical orders as well Here is the necessary screens: ### 1. Login Screen - **Purpose:** Allow users (brokers and photographers) to log in. - **Elements:** - Email/Username input - Password input - Login button - Forgot Password link - Signup link ### 2. Profi...
I currently need an experienced industrial designer who can help me perfect a textile net for my product designed for basketball practice. Online, the main task will be to take the prototype of my existing product and make improvements through computing and then send it to be manufactured.
As a company, we're looking for talented freelance individuals in the Design and Creative field. The ideal candidate should: - Have a strong portfolio showcasing a variety of design projects - Be able to take on projects on a freelance basis - Be active on social media platforms, as it is our platform of choice for posting these positions The perfect fit is someone who not only has the skills and experience in Design and Creative roles, but also is comfortable working on a flexible, project-based freelance regimen. If you're a freelance designer looking to take on some extra work and expand your portfolio, we would love to see what you've got.
I'm in need of a virtual assistant ...would include strong communication, organizational and time management abilities. The most important thing is your willingness to learn and your reliability. Please only apply if you can commit to the specified hours and are serious about this opportunity. Having a computer is mandatory Should have at least 1 year of Virtual Assistance experience + Social networks experience is important + Jobs website handling is beneficial+ Ready to work 100% remote / work from home + Flexible hours + 6 days a week + Full time + Good computer + Good Internet connection + Start Immediate + From any country ( Indonesia / Bangladesh / Philippines / Asia / Africa countries / China / Russia / Bulgaria / Colombia / Peru / Venezuela / South Ameri...
Full Stack .NET Core Developer Needed to develop our whats app api platform A basic requirement is that he has previously worked on the WhatsApp API platform. I can review it before starting work
...in matrix at the bottom in (first column general info, each others column basic contents on specific websites/patent); ...not need easy migration (traslation) !!! Please: present clearly your offer better; ...how many days do you need ? ...what kind of trace/flow do you think ? *all my easy action, now start from === old asset - new asset; Aruba / Italia ...next to Hostinger / Lituania ...next to ...next to ...next to ...next to ...next to ...next to http://www
I'm in need of a professional resume tailored for the technology industry. This resume should be ATS (Applicant Tracking System) friendly and highlight my expertise in DevOps and Site Reliability Engineering. The final resume should be provided in PDF format. Ideal freelancers for this project would have: - Experience in resume writing, specifically for technology jobs - Understand ATS compliance to ensure the resume doesn't get overlooked - Ability to highlight specific skills for DevOps / Site Reliability Engineering - Exceptional writing, formatting, and design skills to make the resume stand out Craft the content carefully, with a full grasp of the technology industry standards and jargon. Your attention to detail will be vastly appreciated. Looking forward to workin...
...1) Linux staging server setup -> deploy our existing project to a new VPS using gitlab 2) Woocommerce -> continue long term development work on our existing custom plugin. Transfer the existing production woocommerce to this staging server. 3) ongoing long term development of our CRM app Other components of our stack which are a HUGE ADDED BENEFIT if you can work on them -> .NET ASP, WEB API + MS SQL DETAILS HERE -> PRIORITY IS TO HAVE A DEVELOPER ON OUR TEAM (LONG TERM) THAT CAN FOR NOW ALSO WORK WEEKENDS AS WE HAVE SEVERAL EMERGENCIES TO FINISH URGENTLY. Someone who can efficiently manage Linux VPS and efficiently use GITLAB is critical. Initially we need part of the hours to be worked in the first weeks from 8:00PM- 2:00am UTC -3 (Brazil Time)
...AS WE HAVE SEVERAL EMERGENCIES TO FINISH URGENTLY. We will start with 5-10 small task in and then go to some smaller .NET tasks all with 1 day sprints for you to become familiar with the software and then our main goal will be to integrate another B2B API for our MVNO. Initially we need part of the hours to be worked in the first weeks from 8:00PM- 2:00am UTC -3 (Brazil Time) later you can work on your time zone. If you are awarded the task we expect you to accept IMMEDIATELY and if the project is not accepted immediatly we will award it to another developer. To qualify you must be full stack and work PROFICIENTLY with gitlab and code in ., .NET ASP, WEB API + MS SQL. We also have woocommerce and have developed and will continue to develop plugins, so PHP and unders...
I'm looking for someone experienced in cleaning out toxic backlinks from my website. The main goal is to improve the website ranking. This task is quite urgent and needs to be completed within a day. This is a 1 hour job! Full video here explaining the job This job will also lead to other jobs, such as ranking our website, high DR backlinks, blogging, creating pages to rank for easy keywords, running keyword reports, etc. I will only respond to offers that have confirmed they have watched the video. I will not answer bot responses. Key responsibilities include: - Utilizing SemRush to identify toxic backlinks - Compiling the list of toxic backlinks in a notepad for Google Disavow backlinks tool - Ensuring that the backlinks are safely removed from our website
I'm looking for a responsible individual to pick up a medium-sized package, weighing between 10 to 50 lbs, and deliver it ...delivered to. The package contains miscellaneous items and doesn't require any special handling or care as it's not fragile. Key Requirements: - Ability to lift and handle packages up to 50 lbs in weight - Located in Sweden and has easy access to a UPS delivery center - Prompt, reliable, and communicates effectively Ideal candidates will have: - Prior experience in courier services or delivery jobs - An understanding of UPS delivery procedures and guidelines - Excellent organizational and time-management skills. A brief briefing will be held to provide any additional information on the package and its contents. Timeliness and reliability a...
I'm looking for a skilled freelancer to develop a customized net worth spreadsheet. This spreadsheet should enable me to meticulously track my financial progress across various categories. Key Requirements: - The spreadsheet should allow me to input and monitor: - Investments (especially individual stocks) - Debt - Savings - Income - Expenses - Other category for miscellaneous expenses or income - I require a simple, user-friendly design that makes manual data entry easy and intuitive. Skills and Experience: - Proficiency in spreadsheet software such as Excel or Google Sheets is essential. - Experience in financial tracking and net worth management is highly beneficial. - Understanding of stock market, investment tracking, and basic accounting principle...
I need assistance with scraping data from a website and delivering it in an Excel file. The specifics of the project are as follows: I am looking for a person who will conduct scraping sessions for our business on a regular basis. Desired skills are knowledge of screen-scraper software, sql, Someone with Python knowledge will be better. Willing to follow instructions. Not cramped up with other jobs or other side hustles. Need to have solid internet connection. Expected work takes 5-10 hours per week, once fully trained. Must be responsible. Able to accept PayPal. - The source of the data is a website. This means the freelancer needs to have experience in web scraping. - The data should be delivered in an Excel file. Proficiency in handling and formatting data into Excel is a mu...
Hello, I have my Python/Django site hosted on PythonAnywhere and it's facing a NET::ERR_CERT_DATE_INVALID issue. Website : I would appreciate someone help to troubleshoot this issue and fix the NET::ERR_CERT_DATE_INVALID error, ensuring that the SSL/TLS certificate is correctly set up. - Website troubleshooting and error resolution - SSL/TLS certificate configuration. Thanks in advance !
I need help with fixing a project and adding new features in core PHP. - **Fixing:** The project needs to address some bugs and issues. - **New Features:** I'm looking to add a partners portal enhancement, scheduling options for cron jobs, and a mail campaign scheduling feature. - **Partners Portal Enhancement:** The focus of this project is on enhancing the partners' portal, such as: - Improving the user interface to make it more user-friendly. - Adding additional features for partner management that will make the portal more functional and useful for our partners. - Integrating with third-party systems to enhance the capability and reach of our portal. Your previous experience in core PHP projects and adding new features will be a big plus for this proje...
I'm seeking an experienced DevOps engineer who is proficient in deploying React Frontend and .NET Core 8 applications to Alma Linux with NGinx server. The candidate should have solid experience with: - Deploying React FrontEnd and .NET Core 8 Web API applications on Alma Linux in GoDaddy VPS. - Knowledge of routing of both applications with one domain and one SSL. - Knowledge of handling SubDomain. - Knowledge of Alma Linux Nginx deployment. - Understanding of .NET Core Application Settings and React.JS application settings - Understanding of Node.JS
### Short Note on Online Jobs **Online jobs** are work opportunities that allow individuals to perform tasks and projects over the internet, providing flexibility and the convenience of working from home or any location with internet access. These jobs can cater to a wide range of skills and interests. Here are some popular types of online jobs: 1. **Freelancing**: - **Platforms**: Upwork, Freelancer, Fiverr. - **Description**: Offering skills such as writing, graphic design, web development, and digital marketing to clients worldwide. 2. **Online Tutoring**: - **Platforms**: Chegg Tutors, , VIPKid. - **Description**: Teaching students various subjects or skills, including English, math, science, and coding. 3. **Content Creation**: - **Platfo...
...your best time . Licensing man waiting for me I have a website model to make ideea about what I need . I will provide the link Please note that I am new to this business. I run a small business, and I need this website to comply with the licensing requirements necessary to obtain a license. I have low budget .The business is private hire, similar to a taxi service, but we can only take jobs through web booking or an app. The website must have five pages: Web site name ANRO is coming from my business ANRO SERVICES LTD and I want to use this nabe ANRO because is short same as UBER or BOLT Home About Us Contact Us Services Book Now The Book Now page should include: A fare calculator Car options (e.g., salon, executive car, estate car) A p...
...across multiple countries with the following features: # Source Selection : The ability to select multiple sources for job scraping, including Google jobs. # Comprehensive Job Details: Extraction of all details included in the job listing, such as job title, company name, location, job description, requirements, etc. # Web Interface: A user-friendly web interface where users can enter the URL of the job listings page and initiate the scraping process. # Downloadable in .csv Format: The scraped job data should be downloadable in .csv format for easy analysis and storage. # Filtering Options: Ability to filter job listings based on old vs. new jobs for specific job verticals (e.g., technology, finance, healthcare) and support for Middle East/GCC countries. # Scalabili...
I need a skilled .Net MAUI developer to assist me with my existing project. The main tasks for this project include: - Fixing bugs: The project is currently experiencing some issues which are negatively affecting the user experience. The specific bugs are not provided in this brief, but I can share details during our discussion. - App Publishing: Once the bugs are resolved, you will be responsible for publishing the updated version of the app to both Android and iOS stores. - Delivery of the final source code and making sure it is running on our machine. The ideal freelancer for this project should: - Have a proven track record in debugging and resolving issues in .Net MAUI projects. - Be proficient in the publishing process for both Android and iOS stores and should b...
...their contact details. - Sales Pipeline Tracking: It should track and monitor the stages of our sales process, helping us identify areas for improvement and potential bottlenecks. - Customer Support Ticketing: The system should provide a platform for our customer support team to manage and resolve client issues efficiently. - Job Sheet Tracking: I also require functionality to track repair/service jobs for various items like phones, PCs, cars, bikes, ACs, etc. Platform and Device Support: - The CRM should be accessible through web browsers, desktop applications, and mobile apps. Seamless integration across these platforms is crucial for our team's efficiency and flexibility. Data Security Measures: - User Authentication: The system should only grant access to authorized pe...
I'm in China now, and i can work as Online Chinese tutor or Android Developer, right now i work for a Canada Company as a translator, but these are part time jobs, and i want you to find job for me, and you can get 10% of the salary i get if you find the job for me. I can give you my resume
I'm looking to create a compelling web design for my HR company. The ori...figma/sketch designs Favorite designs - - - Contents of webdesign of HP in order from top to bottom - Main slider with claim, menu and logo and some call to action button - 3 columns of services - like For Employees, For Employers, Consulting - list of open positions for employees, nicely designed - why to work with us, and some numbers (jobs per month / whatever) - about us - services provided - contact with ability to reserve meeting via Google Calendar - contact form - footer with some basic info (contacts, menu, socials) Very nice inspirations: - -
...the server it is hosted on, my hosting company has notified me that the server load is being reached often due to long running scripts causing the max children connections to be reached multiple times throughout the day, please see a screenshot of the information they have given me on the issue here: They have also indicated that the website appears to have cron jobs running continuously which may be contributing to the over all server load, they have also sent me a screenshot of this issue which can be seen here: They have sent me this link to look at on how it might be able to help with this issue: How to fix high server load due to POST requests Please let me know if you are able to fix the issue along with a
...for this I need a figure so that the developer can follow the design. We will offer both features of the mentioned sites on a single website so we need to combine them in an ingenious way, so I need a designer to create a figma file or similar so that the developer can use it as a guide. we must combine it in ingenious ways. . I need an expert in saas projects Please share your previous related jobs, like behance profile dribble, etc related to saas dashboards or projects Requirements: Proven experience as a UX Designer with a strong portfolio showcasing previous work. Solid understanding of user-centered design principles and methodologies. Proficiency in design and prototyping tools such as Sketch, Figma, or Adobe XD. Excellent communication skills with the ability to pre...
Ideal Skills and Experience: - Proficient in C# programming language and .NET framework - Experience in developing desktop applications - Familiarity with Visual Studio - Ability to implement data encryption and database integration - Expertise in developing secure user authentication mechanisms Please provide relevant examples of your previous work in C# desktop application development.
I need a professional website that aptly portrays my investment advisory services and showcases my portfolio. The website should cater to individual investors, small business owners, and high-net-worth individuals. Key Features: - Detailed and clear information about my advisory services: Candidates with experience in creating informative and engaging content relating to finance or investments will have an advantage. - An investment portfolio section: The ideal freelancer should demonstrate an ability to elegantly display financial data in an accessible manner. - A contact form: Allow visitors to submit inquiries directly through the site. - An investment calculator: This needs to be user-friendly and visually appealing, requiring both frontend and backend capabilities. Ideal...
...accessories field. If you have the creativity and skills to bring fresh ideas and elegant solutions, please send us your portfolio. Let’s create something amazing together! This project involves Arabic-inspired products. Based in Kuwait ?? Thanks Plz read carefully before replying , your 1st understanding of the project will effect my decision..! Attached suggested logo and some references from the net .. regards...
I need a System Administrator to handle both setting up a website using Aruba and maintaining the MX (mail exchange) records. Here's what I'd need assistance with specifically: - Website setup and deployment: This involves general website operation management, hardware and software updates, and ensuring seamless website functionality. - MX record configuration and maintenance: This includes all tasks in relation to managing the mail exchange records - set up, checkups, modifications, and ensuring our web-communication stays efficient and up to date. A candidate with experience in both Aruba website deployment and MX record management will be considered ideal for this job. Knowledge about server troubleshooting will be a plus.
I'm l...outreach, and connections to identify suitable candidates. - Running Portfolios: Coordinate the portfolios of these individuals, tracking their performance and making strategic adjustments as needed. - Generating Portfolios via Events: Plan and execute events that attract potential club presidents and generate new portfolios. The ideal candidate should have: - Proven experience in sourcing high-net-worth individuals - An existing network in the business and finance world - Strong project management skills, especially in portfolio management - Excellent communication and negotiation skills This project will be handled collaboratively, so I'm looking for someone who can bring creativity and strategic vision to the table. Please provide details of your relevant expe...
In this project, I need a freelancer who can meticulously manage data entry tasks. Ideal Skills: - Strong data entry skills, specifically with text data. - Advanced knowledge of Excel and data management within it. - Ability to understand and follow custom data organization instructions. Job Summary: - Enter text data into Excel form...Skills: - Strong data entry skills, specifically with text data. - Advanced knowledge of Excel and data management within it. - Ability to understand and follow custom data organization instructions. Job Summary: - Enter text data into Excel format, understanding the importance of accuracy. - The data must be organized in a specific, custom order that I will provide. - Experience in similar jobs and a keen eye for detail will be highly b...
My project requires an experienced programmer who has the technical abilities to modify an XSL style sheet and adjust its layout. The task will specifically focus on: - Changing the layout of the style sheet and VB code. This modification is needed to appropriately accommodate some new fields that have been added to an import file. - Improving the style sheet so as to automatically map the new fields from the import file. The ideal candidate for this job should have experience with layout adjustments in XSL style sheets, automatic mapping of new fields and VB coding. Your skills and experience in rearranging content layout, updating fonts & colors, and altering data display formats will be highly appreciated. Don't hesitate to place your bid if you can deliver t...
I'm in need of an experienced web developer with strong shell scripting skills. While the main purpose of the website application is not specified, it's targeted at the general public. Ideal Skills and Experience: - Proven expertise in web application development - Experience in creating websites geared towards the general public - Robust skills in shell scripting - Ability to independently make decisions to enhance website functionalities Note: As the tasks for shell scripting are undefined, a flexible way of working is preferred for meeting emergent needs in the project.
...for various roles within my organization. This includes: - Posting job advertisements on appropriate platforms - Screening resumes and profiles - Scheduling and conducting initial interviews - Maintaining and updating recruitment databases Job Description: Having a computer is mandatory Should have at least 1 year of Virtual Assistance experience + Social networks experience is important + Jobs website handling is beneficial+ Ready to work 100% remote / work from home + Flexible hours + 6 days a week + Full time + Good computer + Good Internet connection + Start Immediate + From any country ( Indonesia / Bangladesh / Philippines / Asia / Africa countries / China / Russia / Bulgaria / Colombia / Peru / Venezuela / South America etc etc.,) + You should be able to id...
I have a frontend project built using React and Mobx. The main focus of this project is to clean up the code structure while enhancing the performance of the app. Understanding of .net would be a great plus. Key requirements: 1. **Code Structure Cleanup:** The existing code structure needs to be reorganized and optimized to ensure it's well-maintained and scalable in the future. 2. **Performance Improvement:** The main goal of this cleanup is to enhance the performance of the app. This might involve identifying and removing any redundant code, refactoring certain functions, or optimizing data flow. 3. **Coding Standards:** While there are no strict coding standards in place currently, I'm open to suggestions on implementing best practices. The chosen freelancer should b...
I need an experienced Laravel developer to undertake crucial tasks within a large-scale project over a two-week timeline. The Laravel-specific requirements are a...Laravel. 29. Allow selection of email templates within the current module and associate specific module items with them in Laravel. 30. Integrate SMTP for email sending in Laravel. 31. Enable editing of email templates and sending emails with edited images attached in Laravel. 32. Investigate and resolve any code errors and relationship issues between site visits and jobs, ensuring the proper attachment of site visits to jobs in Laravel. I expect you to integrate these features into a CRM and ensure seamless API integration. Proficiency in Laravel and experience in handling similar large-scale projects will be hig...