Binary append file file vb net punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I've got a PDF that needs to be converted into an APA formatted Word document. This is primarily so I can make edits to the content within. Key Requirements: - Convert a PDF file to Word for editing purposes. - Ensure the Word document uses APA formatting style. - Handle images by extracting them from the PDF and enhancing where necessary. Ideal Candidate: - Proficient in PDF to Word conversion. - Familiar with APA formatting style. - Experienced in handling images in MS Word. - Attention to detail is a necessity.
I am looking for a freelancer who can convert my PDF files into Word documents. The primary purpose of this conversion is to enable me to edit the content within. The layout and design of the converted Word document should closely match that of the initial PDF. The formatting of the PDF is relatively simple, consisting mainly of text with minimal styling.
Don't bid if you are from India, Pakistan, or Bangladesh. ============================================== I'm looking for an experienced .NET professional who can provide hands-on training on LINQ and ML.NET. Key Requirements: - Has academic research experience - Expertise in C# with an emphasis on LINQ and - Ability to provide practical, hands-on training The sessions will need to be conducted online, so the ideal candidate should be able to provide effective virtual training. This training should be interactive, engaging, and tailored to my goals. Note: - Don't bid if you don't have academic research experience
I need a fluent, efficient typist to convert an English PDF into an doc -formatted Word document. Requirements: - The primary task is to convert the text from the PDF into a Word document. The original PDF is in English. - The Word document must be formatted in doc style. Familiarity with this style is a must. Pdf file must be typing and i need word .doc file . The PDF does not contain any tables but does include images. These images need to be included appropriately in the Word document. Ideal Skills: - Proficient typist - Strong understanding of APA formatting - Experience with incorporating images in Word documents Please provide a brief description of your relevant experience.
I'm looking for an experienced .NET professional who can provide hands-on training on LINQ and ML.NET. Key Requirements: - Has academic research experience - Expertise in C# with an emphasis on LINQ and - Ability to provide practical, hands-on training The sessions will need to be conducted online, so the ideal candidate should be able to provide effective virtual training. This training should be interactive, engaging, and tailored to my goals. Note: - Don't bid if you don't have academic research experience
I have a PNG file that I need converted to a vector file for the purpose of applying it to my office glass door.
As a part of an ongoing project, I require an Adobe Illustrator expert capable of handling a number of tasks. My existing AI file needs modifications including removal of map listings. You would also be tasked with making small adjustments or edits to perfect the current design. One crucial job would be aligning and repositioning certain elements within the file. Both the text elements and images/graphics would need adjustment in our quest for that perfect design. You are expected to have a keen eye for detail, expert skills in Adobe Illustrator and a knack for alignment and positioning of elements. A good understanding of color schemes and design balance is also desired. Let's create something amazing together.
si tratta di convertire 2 file - da PDF a formato word il file successivamente verrà tradotto dall'italiano all inglese, e ci interesse mantenere la struttura / foto presenti nel file originario innanzituttto
Flutter Developer Generate ipa file for ready code
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
Dear self-employed people and lead generators, I am reaching out to you as we are looking for talented and independent individuals who can help us generate quality leads in the financial sector. Our goal is to provide potential clients with the opportunity to move forward with their financial goals, and to do this we need your support. We offer a generous compensation of 50 euros net per successful lead generated through your efforts. Leads are captured through a landing page we provide, and you have the option to incorporate your own tracking to monitor the success of your efforts. A successful lead is defined by the customer completing certain parameters, including last name, first name, mobile number, email address and the customer's investment volume. What we expect fro...
This project entails the development of comprehensive user manuals and help files. These resources are needed to meet the needs of a variety of users, including end users, administrators, and technical support team members. Key responsibilities include: • Crafting documentation that details the basic functionalities of the SaaS product for maritime industry • Providing clear instructions for utilizing advanced features • Developing troubleshooting guides and FAQs for common issues The ideal candidates for this task have experience in technical writing, specifically within SaaS products, and are able to both grasp complex software functionalities and explain them in terms that a non-technical user can understand. This project has an urgent timeline and as such, prospec...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
I'm seeking an experienced professional who can proficiently analyze my Windows Server 2008 R2 log files. The primary goal of this task is to troubleshoot potential Networking and appl...troubleshoot application errors within the log files - Provide a detailed analysis report with recommendations for resolution The ideal freelancer for this project should: - Have considerable experience in Windows Server log file analysis - Be adept at troubleshooting application issues - Demonstrate a proven track record of similar work in the past - Be able to provide clear and concise reports - Strong understanding of Windows Server 2008 R2 Your application should clearly outline your experience in this area. Please note that only applicants with demonstrated experience in log file ...
I need a C# dotnet DLL that can be used by Delphi, or actually in C++ Builder (Delphi w. C++ language). The The task is to developa a demonstration of this in Visual Studio 2022 and imported into C++ Builder (preferrably) or Delphi i a solutino that does nothing useful beyond this. Further some discussion on limitations etc. with this approach in the chat.
I'm seeking a PDF editor tool that primarily focuses on basic text editing and supports documents with complex layouts. Key Features: - Basic text manipulation: The editor should allow me to add, delete and modify text in a straightforward manner. No need for advanced formatting or integrated spell check. - Complex layout support: While the primary focus is on text within paragraphs, the tool should be able to handle PDFs with complex layouts including columns and tables. Ideal Freelancer: - Proficient in PDF editing tools - Experience with handling complex PDF layouts - Strong attention to detail I'm eager to find an efficient and capable freelancer who can deliver a tool that meets my stated requirements.
Thank you for your interest in the project. We mainly develop business applications using cloud services, mainly Microsoft Azure. Our focus is on web development using ASP.NET using C#, and we use WPF desktop apps, Fo...Reservation slot, reserved, course, price, options - POST reservation - Required Log processing will be done within each method. There is no use of DB at the moment. - Period 1 week - Budget 500$ Recruitment conditions Those who have been developing with ASP.NET Core for more than 3 years Those who can trade under their real names and sign NDA contracts, Please share your experience with asp.net. .NET engineers who work continuously over a long period of time If you would like to support us, please apply. I would be happy if I could connect with good engineers...
I require a personalized STL file of a trophy depicted as a police officer in public order gear. The key details are: - Pose: The officer should be standing. - Accessories: The officer must be fully equipped with a riot helmet, a baton, a shield, and a round shield. The officer is a MET officer in london. I have a picture of the cutrent trophy if needed. - Its quality must be adequate for 3D printing. For this project, knowledge of 3D modeling software, such as AutoCAD and Rhino, is essential. The file must be accurate, with attention to minute details and the specific accessories to be included. Previous experience in 3D designing trophies or detailed characters would be highly beneficial.
I am looking for a professional with the capabilities of facilitating data file downloads. The data in question does not specifically have to be text, numeric, or multimedia, as I have not stated a preference. However, I need it presented in CSV format for my review and analysis. Key duties include: - Assuring the secure and rapid downloading of data files. - Properly formatting the data into CSV files for easy accessibility and comprehension. The ideal freelancer for this job should possess: - Strong knowledge of data management. - Proficient skills in handling various data types. - Expertise in CSV formatting. - Exceptional skills in file download mechanisms and data security. This task requires a detail-oriented person who can accomplish tasks accurately and in a tim...
I'm looking to hire a skilled .Net Core Developer who can assist in the integration of various APIs into our portal, along with the integration of additional features. Key Responsibilities: - Integration of multiple services: DMT (Domestic Money Transfer), AEPS (Aadhaar Enabled Payment System), M-ATM (Micro ATM), Hotel Booking, Flight Booking, and Bus Booking. - Development of Wallet Management system. - Implementation of Commission Structure. - Report Generation. Ideal Candidates: - Proficient in .Net Core development. - Previous experience with API integration. - Extensive knowledge of integrating DMT, AEPS, M-ATM, Hotel, Flight and Bus booking services. - Strong understanding of Wallet Management systems. - Skilled in developing Commission Structures and Report Gen...
We made a backend and frontend project with .NET Core. Entity Framework was used. The web part is mostly completed. The part that is required is actually running it on a mobile device. I don't know much about the subject. We did it through a friend of mine. But now I have to continue on my own. I need your help with the remaining tasks.
I'm in need of a proficient .NET Core developer, specifically experienced in working with the DICOM standard and utilizing the fo-dicom library. The primary goal of the project is to develop a new DICOM application, with the application intended to run on Web (Cross-platform). Key Requirements: - Advanced Understanding of DICOM: The ideal candidate should be well-versed with the DICOM standard, understanding its complexities and quirks. - Proficiency in fo-dicom Library: Experience with the fo-dicom library is a must. You should be familiar with its nuances and capabilities. - .NET Core Proficiency: You should have a solid background in .NET Core development, with a good understanding of its capabilities and limitations. - Web Development: As the application is i...
I need a fluent, efficient typist to convert an English PDF into an doc -formatted Word document. Requirements: - The primary task is to convert the text from the PDF into a Word document. The original PDF is in English. - The Word document must be formatted in doc style. Familiarity with this style is a must. Pdf file must be typing and i need word .doc file . The PDF does not contain any tables but does include images. These images need to be included appropriately in the Word document. Ideal Skills: - Proficient typist - Strong understanding of APA formatting - Experience with incorporating images in Word documents Please provide a brief description of your relevant experience.
PROBLEM STATEMENT Development is being done on local environment without any staging environment, thus deploying on production may result in errors due to different configurations/libraries. SOLUTION Create a replica of EC2 production server (to be called "development") on AWS, that can be used for development and later for staging (once containerisation and CI/CD pipeline is configured) CONTRACTORS ANTICIPATED TASKS (high level): 1. Take backup of production instance on AWS. 2. Create new instance from the backup. 3. Configure and verify that code can pulled into the instance from bitbucket. 4. Setup required networking, database, monitoring, and Authorisation configurations. 5. Verify that the instance serves web application just like production and reflects any development...
...of a proficient designer with experience in SVG file creation for both laser cutting and etching purposes. The project entails transforming my hand-drawn sketch design into an SVG file format, showcasing simple yet specific shapes. The following are the project specifications: - The SVG file will be used for a medium-sized (1-3 ft) project, meaning attention to detail in scale factor is essential. - The material targeted for laser cutting and etching is acrylic. Hence, prior experience working with this material will highly be considered. Ease in following instructions, excellent communication skills, and the ability to creatively interpret sketches into clean digital designs will be key in picking the ideal candidate. I’ve attached a file with an ex...
I have a lot of data in a spreadheet. Have a look at attached spreadsheet. I need the sheet named "auto made" to be automaticly made. (it is now manually filled with data) What triggers data to be in "auto made" sheet is the value 1 in Ordre!B column. If no value in Ordre!B column the "auto made" sheet will only have headers. Description on where the data is from is described in row 10 in "auto made" sheet. This row 10 need to be deleted to make the spreadsheet work for my import
I'm in need of a freelancer who can help me parse my VCF file and convert it to a different format. The main goal of this task is to extract the genotype information from the file. input will be VCF file (from ONT whole genome run) and csv file with columns containing rsID, chromosome number, position. output will be same as input csv file, with extra column showing genotype from VCF at the given position can run on Mac shell so either perl or python would be fine. Ideal Skills & Experience: - Proficient in parsing VCF files and understanding genotype data - Experience in converting files to various formats like CSV, TXT, and XLS - Attention to detail to ensure accurate extraction of the data - Knowledge of any data validation methods would be a...
I'm in need of a skilled developer who can create a Windows GUI application. This app should be capable of opening and editing a pre-formatted CSV file. Key Features: - The app should have interfaces for inputting free-form English text in certain fields and selecting options from drop-down menus in others. - It must offer normal file saving and opening functionalities. - The design should incorporate a professional and corporate-looking splash screen graphic and an about page. User Interaction: I aim for a straightforward user experience. The app should be intuitive and easy to navigate without the need for an extensive guided walkthrough. Ideal Skills: - Proficiency in Windows GUI app development - Experience working with CSV files and handling user inputs - Strong ...
I'm in need of a professional who can help me edit a PDF document. I would like to make some text edits, add some new text, and also enhance the document with the additio...PDF document. I would like to make some text edits, add some new text, and also enhance the document with the addition of a few images. Ideal Skills: - Proficiency in PDF editing - Skilled in text addition and reformatting - Experienced in image editing and addition I already have the original document that was used to create the PDF, so you can make the required changes directly from the source file. I would prefer someone with a keen eye for detail and design, who can make the document visually appealing as well as functionally accurate. Please reach out if you're confident in your PDF editing and ...
I'm in need of a writwr who can write a report on BNG and also use metric calculator
Wanting a sketchup file with the terrain and image matches and scaled
I am seeking an expert in Excel, OneDrive and email notifications who can develop an automated system for me. This system needs to: - Monitor a specific Excel file within my OneDrive for business for cell value changes. - When changes occur, the system should not send an individual notification for each. Instead, it should group updates together. - These grouped updates should then be sent as a single email to a preselected set of recipients at a specific time interval. - Crucially, the email should not only contain the updated cell values but also their previous values, enabling recipients to easily compare old and new data. Only experienced Excel and OneDrive professionals should apply, preferably with a background in automated data notifications. Familiarity with handling Excel ...
Seeking someone to fix, or create a file: for new hires to complete onboarding forms. Currently, when new hires join our agency, they receive and fill out mountains of paperwork. My agency will not move away from having hand signed forms and documents. Before someone is hired, we mail a packet containing forms to complete and turn in on their first day along with other agency information. When they arrive on their first day, (aside from the documents they’ve received in the mail), we provide more forms to complete. So they’re stressed by starting a new job, and now they have to shuffle through all these forms and papers, it’s a lot to deal with. I’ve already started the process of changing this. My idea is this: new hires will still receive the pap...
I need an experienced 3D designer to modify an STL file quickly. The specific modifications are unspecified, but I need them done promptly. The final deliverable should be an STL file, though I'm open to other file formats. It is essential that the designer has the ability to make complex modifications and is experienced in the software necessary to perform the task. Please bid only if you're available immediately and can work on the project promptly.
I'm in need of a .NET Core developer to create an appraisal system. This system is designed to implement multi-page functionality. The system should be robust and user-friendly, ensuring a seamless user experience. Your primary task will be to build the system according to the provided guidelines. The appraisals can be conducted by the user without the need of connecting to any existing software or databases. Ideal Skills and Experience: - Proficiency in .NET Core - Experience in developing multi-page systems - Strong understanding of user authentication - Familiarity with document uploading - Competency in creating rating and feedback systems The project does not involve any integration with existing software or databases. You will be working on building the appraisal...
I'm looking for an expert in .Net 8 Blazor to enhance our RIS (Radiology Information System) application with several new features, specifically focusing on workflow automation. Key Features to Add: - Workflow Automation: This includes automating the patient registration and check-in process, radiology order entry and tracking, as well as results distribution and notification. Ideal Candidate: - Proficient with .Net 8 Blazor framework - Experienced with Radiology Information Systems - Skilled in workflow automation - Capable of building secure and scalable systems - Understanding of healthcare industry regulations and standards If you have the expertise and experience in these areas, please reach out to discuss this exciting project!
THE PROJECT MUST BE DONE ON MS VISUAL STUDIO - MY BUDGET IS $30-50 , ANYTHING MORE THAN THAT DON'T APPLY. ALSO TIMEFRAME IS 4 DAYS I'm seeking a skilled .NET developer to design an efficient, user-friendly inventory management system for a luxury shoe shop. 1. The Project should have/do the following: a. Product screen • Add product • Edit product • Delete product b. Category Screen • Add Category • Edit Category • Delete Category c. Subcategory Screen • Add Subcategory • Edit Subcategory • Delete Subcategory d. User Screen • Add User • Edit User • Delete User e. Edit Stock Screen • Add Stock Amount of Each product • Edit Stock Amount of Each Product 2. There should be a database for each screen 3. I...
I'm in search of a skilled video editor to work on my projects which are typically 5-10 minutes in length. Requirements: - Experience in Cinematic style video editing is desired. - Proficiency in various editing techniques such as color grading, slow motion, and animated text. - Ability to work on videos of 5-10 minutes. This role would suit someone with an eye for detail, creative flair, and a strong understanding of narrative structure. Please provide examples of your previous work that align with these requirements.
I have an illustration file that needs some detailed work in Photoshop. I am specifically looking for someone who can enhance details by hand, and not just run the file through a software. The main focus will be on small details, specifically the fine lines on characters. I've noted that the print size is showing poor resolution in the eyes of the animals, and this is particularly what I want fixed. The lion and zebra are eye level for a child ( this is a kids playroom) and they need to be better quality....without changing the color and feel of the mural. We have tried using other people and they run it through a software that is changing the other parts of the mural. Key Skills: - Proficient in Photoshop - Attention to detail - Experience in enhancing fine l...
I want someone who can convert my pdf file to word file
I'm looking for a proficient image editor who can make specific changes to a number of files. I am attaching two files. Currently, they say: MTNV Administration MTNV Diagnostics They are in two different formats. So, 4 files. I need them to be changed to say: QED Administration QED Diagnostics QED Operation QED Proxy Administration QED Proxy Operation So, I need a total of 10 files. I will pay a max of $25 for this. I will provide the source files to the successful bidder.
Your assignment in this project will be to design and train a neural network to perform the reconstruction of subsampled images. We will supply you with a codebase that handles data loading. Each data sample you receive from our dataloaders will be a batch of MR images in frequency domain ˜x. You will implement a model which takes these image batches, subsamples them according to a random binary maskM(with code we give you) to receive the subsampled version M(˜x) = ˜xsubsampled, converts the data to xsubsampled (in image domain) and performs reconstruction using a model mθ to receive mθ(xsubsampled) = xreconst. The fully-acquired target image x is also provided by the dataloaders. A naive, vanilla reconstruction model would be provided as reference. You...
...corporate logos and branding materials. The designed logo and branding materials should communicate professionalism and be instantly recognizable. The message thematically tied to the logo should embody clean energy, environmental preservation, and prosperity while highlighting the concept of a new era of re-industrialization in responsible stages of readiness and gradual decarbonization, aiming for Net Zero between 2030-2050, but also centred around freedom to choose, reliability and self sufficiency. Also, the design should symbolize Energy Transition, Innovation, and Best Practice while promoting Responsible Citizenship, Stewardship, and Affordability. Ideally the logo communicates the best value for both industrial and commercial customers, emphasizing an optimal cost-quali...
...corporate logos and branding materials. The designed logo and branding materials should communicate professionalism and be instantly recognizable. The message thematically tied to the logo should embody clean energy, environmental preservation, and prosperity while highlighting the concept of a new era of re-industrialization in responsible stages of readiness and gradual decarbonization, aiming for Net Zero between 2030-2050, but also centred around freedom to choose, reliability and self sufficiency. Also, the design should symbolize Energy Transition, Innovation, and Best Practice while promoting Responsible Citizenship, Stewardship, and Affordability. Ideally the logo communicates the best value for both industrial and commercial customers, emphasizing an optimal cost-quali...
I'm in need of a seasoned professional to develop a new binary trading strategy for Nadex. The ultimate goal is to create a low-risk approach that focuses on effective money management. Key aspects of the project include: - Crafting a new binary trading strategy for Nadex - Prioritizing low-risk configurations - Implementing a money management system that leverages a percentage of the account balance per trade Ideal candidates will demonstrate: - Extensive experience in binary trading, particularly on the Nadex platform - Proven track record of creating successful low-risk strategies - Strong understanding of effective money management techniques, particularly those based on account balance percentages Please note that the goal of this project is to create a ne...
I have a MOV video file that needs to be edited. I would like it to be adjusted to a specific resolution. Key Requirements: - Video editing: Adjusting the resolution of the MOV video file. Accepted Video Specifications: About two small screens Media player: Mirage Screen resolution :2288*1248 Refresh rate:60Hz Video type:.mov About Big screen Media player: Mirage Screen resolution :3536*5616 Refresh rate:60Hz Video type:.mov Ideal Freelancer: - Experience with video editing software - Attention to detail for resolution adjustment - Familiarity with MOV file format.
