Convert vb delphi punët
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I need a skilled Figma designer to help me improve / design a vibrant and engaging design for self-improvement iOS app. I will provide: - Designs that will need to be converted and improved in Figma. See Journey - attached - Suggested Style, See Suggested attached, based on bloom app - Examples of designs There will be from 10 to 20 screens to convert to Figma. Requirements: - Provide the timeframe when you plan to start and finish it. - You will need to improve the designs and suggest the best practices for the app. - Proven experience designing iOS apps in Figma - Portfolio showcasing previous designs in the self-improvement or wellness industries preferred - Strong understanding of color theory and user interaction principles - Ability to balance user-centric design
I am seeking an experienced developer to convert my current image processing project, coded in C++, into Verilog and run on FPGA device using HLS Vitis. The existing project has: - Edge detection capabilities - Image segmentation capabilities The primary goal of this project is not to enhance or alter the images, but to convert the existing codebase from C++ to Verilog, utilizing HLS Vitis. With your expertise: - Maintain the integrity of the current functionalities during conversion - Reframe the C++ code to Verilog language ensuring a seamless running on an FPGA device. The successful bidder should have significant experience with Verilog, C++, and HLS Vitis, as well as a good understanding of Image Processing algorithms, especially Edge Detection and Image Segmentation...
I am looking for someone proficient in typing to convert content from a 30 page PDF into Word and Excel documents. The majority of the content will go in Word with a few items to be transcribed into Excel. Requirements: - High typing accuracy and speed - Familiarity with Word and Excel formatting Specific instructions: - For Word, the content should be formatted in Calibri 12 point font and single spaced. - For Excel, maintain one row per entry for optimal readability. Ideal candidates should have prior experience in similar data entry tasks. Familiarity with PDF conversion tools, text formatting, and spreadsheet management would be a plus.
I'm looking for a skilled WordPress developer to convert my single page HTML portfolio website into a WordPress site. The main goal is to have my portfolio displayed in a user-friendly manner, and I have a design that I would like to be implemented. Key points to consider: - The design for the site is already provided. The chosen freelancer will need to convert this into a WordPress theme. - My website primarily serves as a portfolio for my work, so the focus is on showcasing images and descriptions in a clean, organized manner. - While I haven't specified any particular WordPress plugins to be used, I'm open to suggestions that could enhance the site's functionality and SEO. Ideal Skills/Experience: - Proven experience in WordPress theme development -...
I'm looking for a skilled professional who can convert a Hindi language book in PDF format to an editable DOCX file. Key Requirements: - The purpose of this conversion is to allow easy editing of the text. - The DOCX file should maintain the content in a simple text format without much additional formatting. Delivery Method: - The PDF file will be provided via email. Ideal Skills: - Proficiency in Hindi language to ensure accurate conversion of text. - Experience in PDF to DOCX conversions. - Attention to detail to ensure the content is accurately transcribed. Please keep in mind that the converted document should be easily editable and maintain the original content's integrity. I look forward to receiving competitive bids from qualified professionals.
I am on the lookout for a talented freelancer who possesses excellent writing skills, specifically in the domain of self-help literature. The project involves writing a complete self-help book and will require the freelancer to have: - Strong proficiency in English writing, grammar, and punctuation - Prior experience in working on self-help or similar genre projects - Ability to creatively convert ideas into engaging & persuasive content - Capability to incorporate given feedback with prompt edits Please note, the process will demand a close collaboration and regular communication for providing updates, receiving inputs, and ensuring the project stays on track. The ideal candidate will have diligence for timelines, an appreciation for the genre, and dedication to quality outpu...
I'm in need of an intermediate-level PostgreSQL developer to convert MySQL scripts into PostgreSQL. The tasks I need completed include: - Converting existing MySQL scripts to PostgreSQL. Expect to handle scripts that are between 100 and 500 lines. - Ensuring that the converted scripts work correctly and efficiently. Ideal candidates will have a solid background in both MySQL and PostgreSQL, with a focus on performance optimization. Proficiency in debugging and problem-solving is highly preferred. Please submit your bid if you can confidently translate these scripts while ensuring full functionality and optimized performance. Your experience and portfolio will be a decisive factor in this project, as I place a great importance on proven skills.
I am in need o...Requirements: - Demonstrable experience with effective affiliate marketing and promotion of physical products. - Proven success in targeting and engaging with parents as a specific audience. The freelancer should be able to: - Create and implement a comprehensive affiliate marketing strategy primarily focusing on social media platforms and blogs/websites. - Analyze and optimize the campaign to reach and convert parents. Ideal Skills: - Affiliate Marketing - Social Media Marketing - Content Creation and Marketing - SEO - Understanding of the Parent demographic and market Please provide your relevant experience and how you plan to tackle the challenge of reaching parents effectively. Your proposal should include examples of previous affiliate marketing campaigns an...
I'm reaching out for a freelancer with Kajabi expertise to assist me in setting up a comprehensive automation system on the platform, alongside helping me get my webinar up and running. Key Responsibilities: - Implement Email Automation: I need assistance in setting up an effective system for automated emails that can engage and convert leads. - Develop Sales Funnel Automation: To drive conversions efficiently, I'd like to integrate a well-structured sales funnel automation. - Establish Lead Capture Automation: It's crucial that we capture leads effectively and then nurture them through automation. Webinar Goals: - The webinar on Kajabi has a dual-purpose: generating leads and facilitating product/service sales. Primary Need: - While I have the content and marke...
I'm in need of a professional who is skilled in both graphics and Power BI. Let's collaborate to convert raw data into clear, visual and interactive dashboards. Here are the specific needs for this project: Power BI Tasks - Effectively perform Data modeling, Data visualization and dashboard creation using Power BI - Work with various data sources that include Excel Spreadsheets, SQL databases, Online APIs, and Azure Graphics Tasks: -Even though I didn't specify any graphical needs, any creative approach or design skills you can bring to the project to enhance the visual aspect of the data would be appreciated. Ideal Candidate - Proficient in Power BI - Experienced in working with multiple data sources - Has a knack for graphic design - Detail-oriented and data-dri...
The objective of my project is to construct a comprehensive Regenerative Augmented Generation (RAG) model, bolstered by invaluable internal company data, which I will provide. Specifically, I'm targeting: - The expertise to convert raw data inputs into a functional RAG for superior strategic decisions. - Fluency in managing and synthesizing large datasets. - Demonstrated success in previous related projects. Suitable freelancers should showcase: - Relevant experience in building RAG models. - Proficiency in handling vast internal company datasets. - Strong data analysis and interpretation skills. - Ability to maintain confidentiality of the company's internal information. Looking forward to collaborating on this exciting project!
I am in need of an experienced illustrator with a sharp eye for architectural style and medium-level detail. Your task will be to convert about 100 of my basic 2D and 3D architectural line art illustrations into 3D line art illustrations. The output can be in colourful or black and white, but they should be visually appealing and clean. Ideal Skills: - Proficiency in creating architectural style illustrations - Experienced in creating detailed illustrations - Ability to transform 2D designs into 3D line art The architectural style should be modern, keeping the design minimalist with an emphasis on detaild, cleanliness and appeal. Your creativity will be greatly appreciated in this project, and I look forward to seeing your innovative approaches to this task.
I am in need of an experienced illustrator with a sharp eye for architectural style and medium-level detail. Your task will be to convert about 100 of my basic 2D and 3D architectural line art illustrations into 3D line art illustrations. The output can be in colourful or black and white, but they should be visually appealing and clean. Ideal Skills: - Proficiency in creating architectural style illustrations - Experienced in creating detailed illustrations - Ability to transform 2D designs into 3D line art The architectural style should be modern, keeping the design minimalist with an emphasis on detaild, cleanliness and appeal. Your creativity will be greatly appreciated in this project, and I look forward to seeing your innovative approaches to this task.
I require a copywriter well-versed in the aspect of personal development for individuals, focusing on career growth. The ultimate objective is to convert prospects to clients through engaging and convincing content. This project demands content that will inspire individuals seeking personal development to take concrete steps towards career growth and maintain focus. The right freelancer will: - Have experience in writing for coaching or personal development - Be persuasive and able to convert leads into customers - Understand how to build a credible brand through copywriting In essence, I need a copywriter who can increase website traffic and contribute to building up my brand's trustworthiness. Looking forward to collaborating on this transformational project.
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
I'm seeking a skilled developer to convert Figma designs into a WordPress blog. This task will require: - Strong proficiency in WordPress development - Knowledge of Figma - An eye for blog design will be advantageous Key website functionalities include: - Social media integrations - YouTube integration without autoplay - Implementation of Cookies, AdSense - SEO optimization - Easy mechanism for copying and pasting content. The website will host many blog posts as I'll be uploading AI-generated content often. If you're this person, I'm excited to work with you! IMPORTANT: Good communication skills are required as we will be discussing how the blog will be, its features, functionalities etc. Please ask any questions you have.
I need to convert a complex PDF file into AutoCAD 2021. The original document contains a number of layers and dimensions that need to be accurately transcribed. I prefer working with someone who is comfortable with video calls as I will need to communicate and request revisions through this medium. Your understanding of AutoCAD should be advanced to ensure that the converted file is precise and error-free. Additionally, promptness and responsiveness to video call meetings is crucial for this project.
...for a professional to create a landing page for my consulting office website. Key Requirements: - The main objective of this landing page is to provide contact information to potential clients. It should be designed in a way that makes it easy for visitors to find and use the contact details. Ideal Skills & Experience: - Proven experience in creating engaging and effective landing pages that convert. - Strong understanding of UX/UI design principles. - Knowledge of best practices for contact form design and user experience. - Familiarity with the consulting industry and its typical design standards would be a plus. Please note that the color scheme and specific elements to be included on the page have not been specified, so a degree of creative input will be required fro...
I´ve an web app developed in node.js that now i need to publish to apple store and playstore. No tables or requests to server, all is done on code, need to convert.
I'm in need of a freelancer who can convert my hand-drafted plans into a basic, digital 3D model using Revit. This model will serve as a rough visual representation of the building, primarily focusing on its structural elements. It does not have to have any specific measurements or scale, you can choose what the measurements are, I just want them to look similar to the plans. Key Requirements: - Converting hand-drafted plans into floor plans and a simple 3D model in Revit - Focusing on structural elements, with minimal interior, exterior, and landscaping details - Not required to be accurate in scale or measurements Ideal Skills and Experience: - Proficiency in Revit software - Previous experience with 3D modeling, especially in architectural or building contexts - Ability t...
I need assistance in converting a PDF file to Word for the purpose of editing its content. Specifically, my focus lies on the conclusion section of the document, which requires careful handling due to the presence of complex charts. - Main task: Convert PDF to Word, while retaining original formatting - Important: Special attention to edit the conclusion part - Skills required: Proficient in Microsoft Word, conversion software, and chart interpretation. Your proficiency in understanding and handling similar conversion tasks and ability to edit complex charts will be critical in ensuring this project's completion to high standards.
As an entrepreneur looking to promote my solar products on YouTube, I require a professional who can manage my YouTube Ads with precision and efficiency. The key elements of the project include: - **Targeted Audience and Call to Action**: I need the ads to engage the right audience and have a clear call to action that leads to sales. It's essential to drive quality leads and convert them effectively. - **Scheduling and Automation**: - **Uploading Videos**: I would like the freelancer to manage the entire process of creating and uploading videos for my Ads. The videos need to be engaging and aligned with my brand messaging. - **Optimizing Descriptions**: Properly formatted and optimized video descriptions can enhance the visibility of my ads. The ideal candidate shoul...
I am seeking a skilled freelancer with proficiency in Excel, especially in performing statistical analysis using frequency distribution and creating informative visualizations. To get sp...IMAGE IN A3 AFTER COLORING CELLS - Applying frequency distribution in order to derive significant trends from the data - Creating pie charts that effectively visualize the results and insights gathered from the analysis. The ideal candidate would have experience in advanced Excel functions, statistical analysis, and data visualization. Familiarity with frequency distribution and the ability to convert these results into visually attractive and easy-to-understand pie charts is paramount. Please include examples of similar projects you have worked on in your bid. I am looking forward to your ...
I'm in need of a proficient B2B Lead Generation Expert with a deep understanding of the Technology industry to support my business. The primary goal is to generate quality leads for my tech-focused company. We are looking to cultivate a continuous pipeline of prospects that could potentially convert into lucrative deals. Key Responsibilities: - Utilize a range of lead generation techniques, primarily focused on Email campaigns and Cold Calling, but open to other effective strategies. - Generate less than 100 high-quality leads per month. Ideal Candidate: - Minimum 5 years of experience in B2B lead generation, with a strong background in the Technology industry. - Experience primarily in Cloud Software (Microsoft Azure, AWS), Managed IT Services and Healthcare Information M...
I have a PDF report with mixed content that I need converted into an HTML report for displaying on a website. The final conversion needs to be optimized for desktop viewing. they are 8 pdf files need to be converted to get this done Key Requirements: - Convert a PDF report with mixed content (text, tables, graphs, and images) into HTML. - Ensure the HTML report is optimized for desktop viewing. Ideal Skills and Experience: - Proficiency in PDF to HTML conversion. - Strong understanding of HTML, CSS, and JavaScript. - Experience in converting diverse content types such as text, tables, graphs, and images. - Prior experience in optimizing HTML for desktop viewing.
Convert an existing Wordpress/woocommerce plugin into a shopify app/plugin that can be used for Shopify ecommerce websites. The finished plugin should be listed on the shopify app store once complete. NOTE: SHOPIFY APP DEVELOPERS ONLY - IF YOU HAVENT LISTED AN APP ON THE SHOPIFY APP STORE - PLEASE DO NOT BID. To get an idea of how the Wordpress plugin works and the kind of configuration that will be required for the shopify plugin see the wordpress store page: We do not need any of the age assurance elements building, this is already done. The flow is as follows: 1) User arrives at Shopify Checkout with age restricted product -> 2) Authenticate and launch the Luciditi Web SDK U/I-> 3) Luciditi U/I handles entire age assurance
I am looking for a Shopify Expert Developer who could work on custom development work. Work Details: (This is made on WordPress, admin access will be shared with you) You need to convert this Wordpress website into a Shopify website with exaclty same everything. Timeframe: 4 Days (Maximum) Budget: Rs. 8000/- INR Please don't waste my time if you can't do within this budget or timeframe.
I'm looking for a highly meticulous and efficient freelancer who can convert a simple text PDF file into a Word document. The primary purpose of this conversion is for content editing, therefore attention to detail is paramount. Your tasks will include: - Ensuring the accuracy of the converted document - Noting discrepancies or loss in translation, layout or formatting The ideal freelancer for this project should have robust experience in document conversion and have a keen eye for detail. Strong command of English language implications and nuances is a definite advantage. Accurate reproduction of the original document into a Word file is highly important for this project. Efficiency and speed in delivery without compromising accuracy are also of esteemed value
I need a meticulous data entry professional to help me convert printed documents into a digital spreadsheet with the utmost accuracy. Key responsibilities include: - Typing data from printed documents into a spreadsheet - Ensuring that the data is entered with a very high level of accuracy. To be a successful candidate for this project, you should have experience in high-accuracy data entry. Previous work in a legal or scientific setting would be highly preferred. You should be detail-oriented and skilled in data entry. Your goal will be to ensure that the information is accurately transcribed and organized into the digital format. If you're confident in your skills and can guarantee a very high level of accuracy, I'd like to hear from you.
I'm looking for a highly meticulous and efficient freelancer who can convert a simple text PDF file into a Word document. The primary purpose of this conversion is for content editing, therefore attention to detail is paramount. Your tasks will include: - Ensuring the accuracy of the converted document - Noting discrepancies or loss in translation, layout or formatting The ideal freelancer for this project should have robust experience in document conversion and have a keen eye for detail. Strong command of English language implications and nuances is a definite advantage. Accurate reproduction of the original document into a Word file is highly important for this project. Efficiency and speed in delivery without compromising accuracy are also of esteemed value.
I am seeking a translator and voice-over artist to effectively convert a 10,000-word business PowerPoint presentation into Bengali and Oriya languages. The successful freelancer's responsibilities will include: - Translating the text while ensuring a transformative translation that addresses the cultural context. - Delivering professional voice over in formal language consistent with the business theme. The ideal candidate should: - Be proficient in both Bengali and Oriya languages. - Have experience in transformative translation, specifically tailoring the content to fit cultural nuances. - Have expertise in providing formal, professional voice over services. - Have understanding or background in business presentations is a plus. Please ensure that all translations and v...
I need a freelancer to accurately convert a text-only PDF file into a word document, while maintaining the original formatting. Key Requirements: - Convert text-only PDF to Word - Preserve original formatting - Ensure the final format is editable Ideal Candidate: - Experience with PDF to Word conversion - Strong attention to detail - Proficient in Microsoft Word - Able to complete the task within 7 days
I require a proficient translator to convert a less than 5-minute video from Chinese to English. As such, fluency in both Chinese and English is crucial. Additional experience in video translations would make a candidate highly desirable. Here's what I am looking for: - Ability to accurately translate video content without losing context or meaning - Proficiency in Chinese (source language) and English (target language) - Experience in video translation is preferred Please include samples of your previous video translations in your proposal.
I'm seeking a freelancer who can help me convert my Microsoft PowerPoint presentation to Google Slides, while maintaining a corporate design theme. Ideal Skills and Experience: - Proficiency in both Microsoft PowerPoint and Google Slides - Strong understanding of corporate design principles - Ability to ensure that the converted slides maintain their original design integrity Feel free to reach out if you have any further questions or need more details to make a bid. Thank you.
I'm in need of an experienced android developer who can convert my fully complete Buildbox game file into a working Android APK. Key details: - The Buildbox game file is fully complete and should be ready for conversion. - No specific additional features or functionality are required during the conversion process. - There are no specific design requirements or guidelines, so the conversion should focus primarily on functionality. Ideal skills and experience: - Proficiency in Buildbox and Android app development. - Previous experience in game file conversion. - Ability to ensure a smooth and stable performance of the game on Android devices. - Strong attention to detail to ensure a successful conversion.
I'm looking for someone to convert a .docx format Word file into LaTeX. - Familiarity handling text with tables, and figures in latex.
...specialist to develop an automated reporting desktop application. This tool will structure reports from user inputs and is required to be fully compatible with Microsoft Excel. Therefore, proficiency in Excel-integrated application development is essential. Key Tasks and Specifications include: - Designing and coding a desktop application for report generation - Ensuring the application can accurately convert user input data into structured reports - Implementing compatibility with Microsoft Excel for the accessible and seamless transfer of data The ideal freelancer for this project has a strong background in software development, particularly with creating desktop applications and working with Excel. Experience with coding Excel-integrated apps and understanding of user-friend...
I need a freelance graphic designer to convert my JPEG logo into a vector format. The final output should be ready for print, as it will be primarily used for print materials. I will provide logo on choosing who will do it, to avoid unsolicited emails and contact. Key requirements include: - Converting a JPEG logo into a vector format - Preserving the original colors; no specific color adjustments needed Ideal Skills: - Proficiency in graphic design - Experience with vector graphics - Attention to detail Please include some of your past work in your bid. Thank you.
I'm looking for a talented graphic designer and developer with experience in branding and web design to help me convert my company's logo into a vector format (Illustrator .ai file or SVG). - **Logo Conversion**: I need the existing logo to be transformed into a scalable vector format without compromising its original design. It should be compatible with both Illustrator .ai and SVG formats. - **Brand Guidelines**: Following the color preference of blue, I need a professional and comprehensive brand guideline document created. This will serve as a reference for the company's visual identity, and should be presented in an Illustrator .ai file. - **Website Template Design**: I need a modern and visually appealing website template for the same company. The template sh...
Hi, I'm looking for someone to convert a website currently made in Wordpress into a NextJS website. The current wordpress website has : - 8 differents pages - 2 collections for the CMS, one made of 8 elements, another one made of 13 elements. - no authentication or user management - current content is in French, but no need to understand french to made it, content is simple, with no ads or whatever. Made with Oxygen Builder. I guess the html is a mess due to be done by a builder. The website has no fancy css animations, it's a simple website made in 2021. The goal of the project is to convert this website which is currently running on wordpress into a NextJS website AppRouter in version 14+ made with Typescript, collection will be converted into md files in...
...should have a proven track record in growing brand awareness on social platforms. - Drive Website Traffic: Our second goal is to drive organic traffic to our website. We're looking for someone who can create engaging content that compels our audience to click through and explore our site. - Generate Leads/Sales: Ultimately, we aim to convert our social media base into paying customers. You should be experienced in crafting and executing campaigns that convert followers into leads or sales. Target Audience: - Young adults aged 18-24 - Professionals aged 25-34 - Parents aged 35-44 Ideal Skills: - Proficiency in Portuguese and English - Previous success working in the Brazilian market - A strong understanding of social media strategies for each platform (Facebook, Ins...
I need an expert to create a floor design for a medium-sized office, a space around 840 sqft. I will give the layout mentioning th...by myself but got stuck with another one. More similar work will follow if you do it correctly, quickly and under my budget. Payment by freelancer.com site only. What I will give: #1: Floor plan layout #2: Electrical layout (based on the floor plan ) #3: Light plan layout (based on the floor plan ) What you have to do: #1: Convert Floor plan in AutoCad #2: Convert electrical layout in autocad (based on the floor plan, add annotations & symbol legends ) #3: Convert light plan layout in autocad (based on the floor plan, add annotations & symbol legends ) Ideal Skills & Experience: - Extensive knowledge in Autocad When I n...
My goal is to significantly increase our credit card acquisitions focusing primarily on young professionals. I'm seeking a tenacious salesperson with a knack for direct selling. They should be ready to engage a younger demographic, paint a compelling picture of our offerings, and convert prospective clients into lifelong customers. Experience in the financial sector, particularly in a sales position, is highly valuable. More importantly, an understanding of the young professional's financial needs and aspirations will prove beneficial. Key Skills: - Expertise in direct selling - Experience in the banking or financial services - Understanding of financial needs of young professionals - Exceptional communication skills - Outstanding customer service and relationship buildi...
I'm eager to commision a proficient video editor to finesse and create a captivating, professional video that runs for more than 3 minutes. The project comprises editing raw interview clips to present a polished, final product. Ideal Skills and Experience: - Adept at handling and enhancing inte...present a polished, final product. Ideal Skills and Experience: - Adept at handling and enhancing interview footage - Capacity to provide creative input will be a bonus - Prior experience in long-form video editing - Meticulous attention to detail - Proficiency in video editing software and tools. Your advanced skills in video editing will be instrumental for this project and your ability to convert raw interview footage into a professional, engaging +3 minute video will be high...
I'm in need of a skilled professional who can convert an images into a DXF file optimized / symmetrical for CNC cutting. Key Requirements: - Expertise in DXF conversion: I specifically need the conversion to be high-detail, including all fine features of the original image, to ensure the CNC cutting is accurate and precise. Ideal Skills and Experience: - Proficiency in CAD software: You should be adept at using CAD software and have a keen eye for detail to ensure nothing is lost in translation from the image. - Prior experience with CNC and laser cutting: An understanding of how these machines operate and the requirements for their files is essential for this project.
Our company develops both desktop and web applications tailored for analysing insurance premiums. These have been developed in Delphi over the past 25 years. We are seeking to establish a long term relationship with an experienced Delphi programmer with exposure to Microsoft SQL databases. ASP.net application experience is also desirable. Our software packages require continued upgrading and enhancement and given the specialist nature of our software we are seeking to establish a long term relationship. The primary requirements include understanding our business process and system design, determining and articulating technical solutions, and implementing the design into build and install stages. Australian based is preferred, our principal office is based in Sydney NSW. ...
I am seeking a translator who can convert specialized medical terminologies from Japanese to English. The focus is primarily within the field of General Medicine. The translated documents will be utilized for medical publications. - Strong competencies in both Japanese and English languages are necessary along with an understanding of medical terms related to general medicine. - Experience in medical transcription or translation, especially within targeted field, will be highly advantageous. - Accuracy, attention to detail, and confidentiality are vital in the execution of this task. - Knowledge of medical writing style and conventions, and ability to convey meaning clearly for an international audience is preferred. - The task requires not only translating language, but also co...