How to call crystal report in vb net punët
Call me Sachin 9833358362
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
See attachment. hfghjhgfghjhgfdsdgklkjhgfghjklknvbnmnbvcvbnm,.mnbvertyuytrertrghjugfdghjkjhgfdgkjhgfdfgjkjhg
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I am in need of a skilled video creator who can produce a compelling mixed media video. The primary objective of this video will be to promote our product to a target audience of business professionals. Key requirements: - The video needs to be a combination of animation and live-action elements. The animation should be engaging and professional, while the live-action parts should be shot in a way that resonates with our audience. - As this is a product promotion video, clear and effective communication of the benefits and features of the product is essential. The video should be able to convey a strong call to action. Ideal Skills and Experience: - Proven experience in creating mixed media promotional videos. - A solid unde...
...travelers staying in hotels and B&Bs. It seamlessly connects guests with local restaurants through a digital menu accessed via QR codes in their rooms. Tasteat enhances the guest experience by offering a convenient and diverse selection of local gastronomy, allowing travelers to enjoy authentic local dishes without leaving their accommodations. We are seeking a talented graphic designer to create an attractive call to action set of materials (e.g., table tents, frames, refrigerator magnets) that will be displayed in hotel rooms, public areas, and in houses/apartments. These materials should promote our service and engage visitors to scan and order. Each design should contain a QR code that guests can scan to acce...
I am looking to fill a longterm editor position for multiple projects for my agency. I run a short-format content agency that edits videos for various coaches, businesses and podcasts. The videos are up-to 60 seconds long and I expect you to edit subtitles, b-roll, stock footage, dynamic motion/graphics and make the video in general: entertaining and highly engaging. I am looking for a person that can be my full time editor for the next 6-12 months with the possibility of consistent pay-raises when the agency experiences growth. You will be paid 7usd for every video-edit. The process is super streamlined. All videos are tailored by me -> you get the raw footage, edit it and upload the edited videos in a separate folder. I expect a simple thumbnai...
...media marketing agency dedicated to helping businesses thrive in the digital landscape. Our team is passionate about crafting creative strategies and delivering measurable results for our clients. *Role Overview:* As a Lead Generation Expert, you will play a crucial role in identifying and engaging potential clients interested in our social media marketing services and closing deals with them. You will utilize various research and outreach techniques to identify leads, initiate conversations, setup sales call, and nurture relationships with prospects. *Key Responsibilities:* 1. Research and identify potential clients through online platforms, industry directories, and social media channels. 2. Develop and maintain a database of leads, ensuri...
I need a POC Flutter project that runs on iOS based on these 4 Flutter pub packages: 1. 2. :// Application flow: 1. On Start app if not authenticated, show screen with Login button (middle of screen) 2. When Login button is clicked, goto Okta authenticate 3. If Authenticated : 3.1 Goto to new screen with big round button in the middle of the screen -> "SCAN" 3.2 When clicked, a BLE scan is started for 4 sec. 3.3 If one specific BLE device for the scan is found (based on ID), present faceID prompt and if succeded call a function with haptic feedback 3.4 then back to screen with "SCAN" Button That's it, so all code is available in the pub example packages, I just need a merged project
My project requires the expertise of a freelancer with in-depth knowledge of XBLR accounting. The task is to leverage this skill to generate accurate financial reports for my business, with a specific focus on income statements. Key Responsibilities: - Compile, analyze, and present precise income statements - Ensure the inclusion of gross profit, operating income, and net income in each report. Ideal Freelancer: - Proficient in XBLR accounting - Proven experience in compiling and presenting income statements - Ability to pay attention to detail to ensure accurate financial reporting - Understanding of accounting regulations is highly desired, although not mandatory.
...Hauptzielgruppen: - **Privatkunden**: Personen, die individuelle Finanzberatung für persönliche Investitionen, Altersvorsorge, und Vermögensaufbau suchen. - **Gewerbekunden**: Unternehmen, die Beratung in betrieblichen Finanzangelegenheiten, wie Liquiditätsmanagement, Unternehmensfinanzierung und betriebliche Altersvorsorge, benötigen. #### 2. **Design und Benutzererfahrung** - **Benutzerfreundlichkeit**: Intuitive Navigation, klare Strukturierung und schnelle Ladezeiten. - **Responsives Design**: Optimiert für alle Geräte (Desktop, Tablet, Smartphone). - **Professionelles und Vertrauenswürdiges Design**: Farbpalette in Blau- und Grüntönen (für Vertrauen und Sicherheit), seriöse Bilder, klare und gut lesbare Schr...
You are required to write a report of 2400 words or equivalent in the style of a journal paper on an advanced contemporary topic in computer science. Your report should have the form and the style of a research publication and should have at least 12 references from journals, refereed conferences and other resources Ideal Skills and Experience: - Experienced in report writing - Able to conduct thorough research - Capable of writing in an engaging and informative manner - Able to work with minimal guidance.
I am in need of an experienced professional who can help with an enhancement to our powerflow analysis utilizing Power Factory software. This project is primarily focused on conducting a comprehensive powerflow analysis to improve the efficiency and reliability of our power systems. Key Responsibilities: - Conduct a powerflow analysis using Power Factory software - Implement enhancements to improve overall power system efficiency - Ensure compliance with regulatory standards and best practices - Provide a detailed report on the analysis and suggested improvements Ideal Skills and Experience: - Proficiency in Power Factory software - Strong background in power systems analysis - Familiarity with power losses, voltage stability, and power t...
I am in need of an experienced developer with a strong background in Xamarin. Specifically, I am looking for a professional who can migrate my current Xamarin application to .NET 8. The ideal candidate should be well-versed in: - Xamarin Framework: As the current application is built on Xamarin, the developer must possess a deep understanding of this framework. - .NET 8: I require the application to be migrated to .NET 8. The successful bidder must have a proven track record in migrating applications to this platform. The developer should also be well-versed in the following: - Mobile App Development: Experience in developing and migrating mobile applications is a must - Understanding of E-commerc...
...aspects of Salesforce. Key Responsibilities: - Assistance in Data Migration: I need a professional who can aid in moving data seamlessly within Salesforce. - Workflow Automation: I require help in setting up and fine-tuning workflow automation on my Salesforce platform. - Customization of Fields: Expertise in customizing fields to suit my business requirements is a must. - In-Depth Understanding: I need assistance with Apex, admin topics, Einstein Analytics, LWC, and Aura – so a comprehensive understanding of these areas is crucial. - Specific Features: The ideal applicant should be adept at Apex development, Salesforce administration, Einstein Analytics, LWC, and the Aura framework. Specifically, I want to implement custom repo...
...with a strong grasp of the iOS design guidelines to revamp the UI of an existing app found on Google Play or the IOS store, that currently does not comply with the iOS design guidelines. The goal is to provide a fresh, visually engaging design that adheres to the iOS standards. Key Job Features: - Redesign of the entire app UI with a primary focus on visual design. - Ensuring the new UI is fully aligned with the iOS design guidelines. - Retain and enhance the core functionality of the app for a seamless user experience. Deliverables: Task 1: Redesign the user interface for an application. • Show 9 sketches of the interface design, Images, screenshots, ets. Task 2: Design 3 posters for the phone application. • Design poster that calls to shop on...
...skilled developer to create a personalized billing software that caters to my business needs. This program should be compatible with the Windows operating system. Must-Have Features: - Inventory Management: The software should assist in tracking, restocking, and managing our inventory efficiently. - Customer Management: Maintaining customer details for smoother transitions and personalized customer experiences is crucial. - Sales Reporting: We require comprehensive sales reports to review our business's progress and areas for improvement. Users: The software should easily accommodate 1-5 users at once, with unique access capabilities for each user. Ideal Candidates: I'm seeking professionals with experience designing and developing business-cen...
I need someone to help me with my weekly projects that involve Quality Assurance Testing and Consultancy services for a few major international tech firms. Projects and work are continuously available so there is plenty of work weekly We will work through remote working software to connect to our local machines using this software, not the other way around so there is nothing to worry about your privacy. Testing will be done on Windows desktop and will mainly involve QA checks and regression Testing of certain software. All testing done are on confidential pre-release test builds so discretion of what you test IS IMPORTANT. Please acknowledge this in your proposal. An NDA will be signed in this regard. I require someone with excellent IT skills ...
...looking for seasoned freelancers to enhance my Epic Fitness Coach website. The improvements should focus on user-friendliness, interactivity, responsiveness, and aesthetics. Project Requirements: • Forms and Thank You Pages: Implement forms, thank you pages, and email responses for seamless user interaction and lead generation. • Contact Options: Replace the contact button with a simple white band featuring options to schedule a call or contact via WhatsApp. • SEO-Optimized Blogs: Develop engaging blog content focusing on relevant keywords and SEO best practices. • About Us Section: Revamp the About Us section to be concise, interactive, and visually appealing. • Live Chat Support: Integrate a live chat feature for real-t...
More details: *What specific type of claims do you expect the expert consultant to identify? Delays, Cost overruns, Scope changes *How many projects do you need the expert consultant to review? 4 *Project documents will be supplied. *Reference Contract: FIDIC Red Book *How soon do you need your project completed? ASAP
House plans to be completed. Mark ups provided in 2 stages. DWG provided. You need to have experience in completing drawings for building approval. This job may need revisions once submitted for building permit. After revisions the job will be complete. Mark ups need to be reflected on entire set of plans (10 sheets in all) We will need to have at least one phone call to clarify the job.
...is home to exceptional high-net-worth individuals who are self-made, often billionaires, entrepreneurs, nobility, high-level professionals, and elite members. The company needs talented artists who are experts in abstract and landscape watercolor and oil paint. We have a preference for the following: - Impressionistic style for the watercolor paintings - Impressionistic style for the oil color paintings - Abstract style for the watercolor paintings - Abstract style for the oil color paintings - Subject matter focused on beautiful landscapes and abstracts The ideal artist would have a strong portfolio that includes landscape paintings, particularly in impressionistic or abstract styles. Experience in both watercolor and oil mediums is a must. Please...
I need a dedicated freelance professional to assist me with data research and entry for a project involving database management. The ideal candidate should have: - Proficiency in web data collection and entry - Experience in database management - Strong attention to detail and accuracy The task involves the following key aspects: - Research and collection of specific data from websites - Data entry into a database - Ensuring all data is accurately entered and categorized The data collected is crucial for managing the website, so precision and dedication to the task are paramount. I prefer to receive the data in the form of a detailed report, as it will help me optimize and manage the website more efficiently.
I am looking for someone to create a custom vehicle repair shop software for me, in VB.NET, Windows Form project, using .NET Framework 8. The full source code must be provided. Attached is the full project requirement
I'm seeking a expert to seamlessly integrate the Gemini API within my existing app. This integration needs to facilitate real-time updates on specific information. Key Project Details: - The primary focus of this integration is to enable real-time chatbot updates and basic reporting. - The API should provide up-to-date data when I request a report. - This isn't for automating trades or portfolio performance monitoring but specifically for keeping the chatbot informed with the latest updates. Ideal Skills and Experience: - Proficiency in with a proven track record of API integrations. - Deep understanding of the Gemini API and its capabilities for real-time data. - Prior experience in developing chatbots or similar interactive...
...who can create a database in MS Access for Invoices Log (tracking for already processed invoices) with the following features. 1- A list of all invoices (Master List) with the field names I will provide. 2- A list of all Contracts with the field names I will provide. 3- A list of all Purchase Orders. 4- A list of Approvers who is approving the invoices. 5- A list of Accounts. 5- All of these list should be linked with each other. The database should have a login page. After Login, there should be a a Main Page, with link to the above mentioned list pages plus, Add Invoice, Search Invoice, Search Approver, Search Contract, Search PO, Search Account and Reports pages. For Add New Invoice page, I should be able to add an invoice details in it, and if it'...
I am in need of a skilled QA professional who can meticulously test mobile applications and websites, identifying bugs and ensuring they are addressed before the software goes live. It's key to have the most recent iPhone and a Samsung Galaxy, as the platforms need to be tested across these devices. Key Responsibilities: - Review mobile apps and websites - Detect and report bugs - Ensure issues are resolved - Communicate with developers effectively - Test across the latest iPhone and Samsung Galaxy What I'm Looking For: - Proven experience in QA testing - Proficiency in detecting and resolving functional bugs, performance issues, and user interface glitches - Excellent communication skills to report bugs and issues effecti...
As a client, I'm in need of a gifted freelancer who will design an AI chatbot that works hand-in-hand with Google Assistant. This chatbot will be programmed to carry out multiple tasks: - Answer typical queries - Offer relevant advice - Schedule meetings - Perform any function that is currently possible for it to do verbally The AI chatbot should be compatible with Slack and eventually extend to all phone applications. The chatbot should integrate with a database. We could explore other data integration requirements during our discussions. Ideal applicants are those familiar with AI chatbot programming, Google Assistant integration, and broad-reaching app compatibility. Database integration knowledge is essential, with bonus points for those who...
...web scraping and data analysis firms to conduct a comprehensive data collection and analysis project. The purpose of this project is to gather detailed information on menu items, pricing, customer ratings, promotions, and deals from various food delivery mobile apps operating within our city. The goal is to mine this data for actionable insights to inform our advertising, promotional strategies, and competitive benchmarking. 2. Project Scope The selected vendor will be responsible for developing and implementing a solution to: • Subscribe to and navigate through multiple food delivery mobile apps. • Collect data on menu items including descriptions, pricing, customer ratings, and associated promotions or deals. • Move systematica...
I need a skilled C# Winform .NET developer to protect my application using obfuscation techniques. The goal is to prevent reverse engineering and ensure the highest level of security. Key Requirements: - Implement Basic name mangling, Control flow obfuscation, and String encryption for the application. Ideal Skills and Experience: - Strong proficiency in C# and .NET framework - Prior experience with implementing obfuscation techniques - Knowledge of application security best practices This project is a great opportunity for a developer with a keen interest in application protection.
...appreciated. Complete, operational, custom web site for drop shipping business. Use whatever language is best suited, we prefer word press (this allows us to do minor modifications inhouse- no programming expertise). Along with the web site, suggest name (search on net and proposed office locations), design logo and compose tagline. All copy by client. Topics covered: Vision, mission, contact, FAQ, terms & Conditions, Returns, Refunds, Shopping from a catalog, Live+Chatbot, order processing, confirmation, tracking, cancellation, payment processing, credit, debit, digital wallets, EFT, (No COD, No Checks)Shipping choices and info, Shopping cart, Days to delivery, Visitor, customer mailing list, Loyalty program, Social media accounts, FB, Whatsapp, Youtube, Insta...
I'm looking for an experienced Power BI developer to create bespoke reports and dashboards, which will be integrated into Microsoft Teams. Tasks: - Handling data from Excel spreadsheets and converting it into insightful reports and dashboards. Skills and Experience: - Strong command of Power BI for report and dashboard creation. - Proven experience with Excel spreadsheets. - Good knowledge of integrating Power BI into Microsoft Teams. The goal is to make complex data easy to understand, facilitating better decision-making within our team. Your work will directly impact our day-to-day operations and strategies.
Create a presentation for an annual report in either a Microsoft product (Powerpoint, Word) or Google (Docs, Slides). The presentation will be based on data provided - a draft is attached but it is not yet final. Attached is a style of presentation that I am comfortable with, but another style could also be perfectly suitable. The ability to start on this immediately (after I provide the final draft) and finish it quickly is important.
Money and all it takes to make it in easy steps even a 14 y/o can deal with
...looking for an experienced professional to create a visually appealing email template. The template will be used on my domain-based email account for an email campaign aimed at increasing product sales. Key requirements: - Creation of a visually appealing, professional and engaging email template. - Ensuring the template is compatible. - A well-designed layout that can effectively deliver our sales-focused message. - Understanding of email marketing best practices, i.e., user-friendly design, call-to-action placement, etc. Targeted Customers: Entrepreneurs, Company Owners, Founders, Investors, Rich People, Executives and Directors, Research Professors Message to be delivered: We are offering Product Design & Development Service. Now, we need to ...
...data using Google Forms in Arabic, and I am looking for a freelancer to perform a statistical analysis using SPSS. Key Deliverables: - Statistical Analysis: The main goal of this project is to conduct a statistical analysis on the data. The analysis should focus primarily on descriptive statistics, so the candidate should be proficient in this area. - Detailed Report: I need a report that delves into the analysis of the data in depth. This report should include detailed tables and charts. Ideal Skills and Experience: - Proficiency in SPSS: The chosen freelancer must be well-versed in using SPSS for statistical analysis. Previous experience working with Arabic data would be a plus. - Data Analysis: A strong bac...
