Project vb super market punët
Eshte nje projekt super i bukur nga donald bukuroshi
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
Potrebna mi je konfiguracija nasog OpenCart shopa za srpsko trziste. Porzes, mogucnosti placanja etc. Uz to treba i manji redesign i posle sajt optimizacija za google. Petreban je freelancer iz srbije / hrvatske za duzu saradnju. Nebi bilo ni problematicno da promenimo sistem (magento) I need help about my shop site - currenty Open Cart System - for the serbian market. The VAT and checout configuration hast ot be made, and some smaller backend tasks. Also I woul dlike to redesign some elements of the current theme - nothing special. And further I will need SEO (clothings). I am looking for a serbian / croatian freelancer to work with permanent.
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I am looking for a skilled freelancer to help improve the ranking of my new YouTube channel with a focus on the Christians in the Indian market. The ultimate goal is to enhance the visibility of my videos by optimizing the content and channel in a way that resonates with the target audience in that region. Key Requirements: - **SEO Expertise**: Understanding of YouTube's algorithm and ability to optimize video titles, descriptions, tags, and thumbnails for improved ranking. - **Content Strategy**: Craft a strategy to align my Christian religious content with the preferences of Indian viewers. - **Audience Analysis**: Insight into the demographics and behavior of the Indian audience is an advantage. - **Channel Monetization**: Though not the primary goal, knowledge on channel...
I am replacing a key person to run my WordPress website which includes uploading videos to You Tube, using trello for task management. This person should be able to create compelling written content with entertaining images, info graphics to sell news with the least te...content. We know how long each task takes, so need someone that is fast, an amazing, engaging click bait writer and content creater who wants to make betweek $10/ $25 usd ph + success fees and bonuses . Time: 4 hours every day/ 7 days. 2 over night from 7pm to 7am, so we can sign that work off, and 2 hours during the day between 7am and 3pm nzt to recieve news that can be produced and published super fast. We own 1.5 m social media followers, so have reach. Read about us here.
Seeking an experienced marketing professional to assist in improving the clientele and market presence for my HR services business. This enterprise offers specialized services in recruitment and staffing, training and development, as well as HR consulting. The primary clientele targets are small-to-medium businesses and large corporations. Key objectives are: - Revenue Growth: Implement strategies to acquire more clients and subsequently increase revenue. - Market Expansion: Utilize innovative approaches to expand our market presence. - Enhanced Brand Reputation: Apply brand strengthening tactics to enhance our corporate image and reputation. Ideal candidates should be well-versed in business-to-business marketing, with proven expertise in strategies that attract sma...
Collaboration Context: We are looking for a senior freelance SEO consultant to work on an annual SEO project for a well-known small appliance brand in the United States, which is part of an international group. The website is an e-commerce site. This profile will work integrated into the SEO team for AMERICA that the client has formed, along with other management and technical members so that teamwork will be an essential condition. The project is a global project where each region has its strategy, but all must go hand in hand. The consultant will become part of our network of freelancers, with the possibility of participating in other projects for which a profile like theirs is sought. What do we offer? - The possibility of joining a multicultural team and working...
...researcher to investigate retail displays in Xian, China. The project will specifically focus on Talens, a famous art supply brand. The research aims to provide insights into the following aspects: - Brands Available in Displays: The core of this project is to identify and analyze the presence and positioning of Talens within the retail space. - Competitor Analysis: While the primary focus is on Talens, it will be valuable to understand how other brands like Nike, Adidas, and Apple are being displayed in the retail outlets. - Customer Behavior: I'm particularly interested in how the retail displays are shaping customer behavior and purchase decisions. Ideal candidates should have a background in visual merchandising, market research, or a related field....
I am in need of an experienced Pine Script developer to help me create a custom indicator tailored for the Forex market. Key responsibilities: - Collaborate with me to understand the goals and specifications of the indicator - Design and develop the custom indicator using Pine Script Desired skills and experience: - Extensive experience with Pine Script and trading view platform - Solid understanding of Forex market - Efficient and accurate code writing skills - Excellent communication skills Please note, this project does not require specific inputs for this indicator as I opted to skip this section. The specifics of the indicator will be a topic of our initial discussions. Your input on what might work best will be highly valued. Ability to contribute ideas and...
...Segment data entry into the following comprehensive sections: *Employment Income:* - Allow clients to input their before-tax income from employment. *Property Data Collection:* - Number of Properties: Implement a dropdown menu enabling selection from 1 to 50 properties. - Property Details: Facilitate entry of detailed information for each property, including: - Address - Current Market Value - Purchase Date - Loan Details: BSB, Account Details, Loan Type (e.g., fixed, variable), Remaining Term, Interest Rate, Repayment Amount There may be more than one loan per property - Rental Income - Lender Details - Loan Purpose (e.g., Owner Occupied, Investment, SMSF, Commercial) - Growth Since Purchase % - Offset Account Confirmation attach...
...Requirements: - **Location Selection**: I'm particularly interested in high foot traffic areas and those close to colleges or universities. Your advice in this area will be crucial. - **Demographic Understanding**: My target market includes students and working professionals. I'll need you to guide me in ensuring the franchise is appealing and accessible to this audience. Ideal Skills and Experience: - **Investment Advisory**: Previous experience in advising on successful food or cafe franchises would be a major plus. - **Market Analysis**: Understanding the Jaipur market and its nuances, particularly in terms of location and demographics, is key. - **Communication Skills**: You should be able to explain complex financial concepts in an accessible way to ...
I need a skilled graphic des...is outdated. I need a modern and sophisticated font for my brand while keeping the essence of the current logo. - Simplified Graphics: The current graphics in my logo are intricate and difficult to understand. I need them to be simplified yet still convey the essence of our brand. - Projection of trustworthiness, elegance and timelessness. Intended Use: The primary objective of this logo is to project professionalism. I want our target audience, which consists primarily of families, to see the logo as a symbol of credibility and trustworthiness. Ideal Freelancer: - Experience in graphic design, preferably with a portfolio that showcases logo redesigns. - Ability to understand and implement a professional, family-friendly aesthetic. - Good communicati...
I'm in search of a skilled freelancer familiar with API integration and betting sites to help me with a project. - The main task is to connect our betting site with a sports betting API. - Following that, I'd like to expand our market to include Football, Basketball, and Tennis. - The integration should help retrieve two main types of information: live scores and odds & betting lines. The ideal candidate for this project should have: - Profound experience in API integration, particularly with sports betting APIs. - Strong knowledge of Football, Basketball, and Tennis betting markets. - Be capable of managing live data and converting it into meaningful information for our platform. - A good understanding of odds and betting lines would be a bonus. If y...
I'm seeking a professional CV writer to craft a top-notch resume for a job application within the Technology industry. This CV should be specifically tailored towards an executive-level position. It should be persuasive and able to highlight my significant achievements in the tech industry while demonstrating the skills and experiences that make me a fit for top executive jobs. Ideall...executive-level position. It should be persuasive and able to highlight my significant achievements in the tech industry while demonstrating the skills and experiences that make me a fit for top executive jobs. Ideally, you should have experience in writing CVs for top-level tech industry professionals. The completed CV should also be compliant with ATS screening, and ultimately help me standout in the...
I'm looking for a seasoned researcher who can provide me with a comprehensive analysis of the best food franchises in Jaipur, India that fit within a...analysis background, preferably within the food industry. - Previous experience in the franchise sector would be a significant advantage. - Knowledge of the Jaipur market would also be a plus. Key Requirements: - A detailed, well-structured report on the researched franchises with a focus on the brand OneBite Tealogy. - The report should include market insights, financial requirements, and competitive analysis. - A summary outlining the pros and cons of each franchise option. The chosen candidate will play a key role in shaping my decision-making process, and in helping me to identify the most viable investment options...
...the cryptocurrency market. Key Requirements: - Develop a custom EMA strategy: I'm looking for a tailor-made EMA strategy that will help me to effectively analyze the cryptocurrency market. - Implement strategy on TradingView: The strategy will need to be integrated into TradingView, a platform that I am comfortable using. - Alerts for EMA crossovers: The strategy should include alerts for EMA crossovers, which are a key component of the trading approach I'd like to take. Ideal Skills and Experience: - Extensive experience with TradingView: You should be well-versed in using and customizing indicators on the TradingView platform. - Proficiency with EMA strategies: A strong background in developing and implementing EMA strategies, particularly in the cryptocurren...
I am seeking an experienced SEO consultant...consultant with a proven track record in gaining top search results on Google, specifically within the local market. Key responsibilities and features include: * Optimizing my website for Google's algorithm to place it within the top 5 search results * Focused targeting of the local customer base for my escort service * Carefully balanced keyword use, revolving around the terms related to escort service and call girls, to increase visibility among local searches without overstuffing Expertise Needed: * Strong knowledge of Google's ranking algorithms * Experience with local SEO * Prior success in bringing websites to top search rankings * Understanding of the escort service market is a plus but not necessary. Looking...
...goal for this project is to attract investors who can support our international growth. Key Objectives: - Develop detailed financial projections: We need a professional who can create a comprehensive and realistic financial model that incorporates various elements such as revenue streams, costs, and growth potential. - Design Go-to-Market Strategy: This will involve formulating a detailed plan on how we can enter and penetrate the US and Mexican markets, highlighting key milestones and tactics. Requirements: - Expertise in Financial Modeling: Demonstrated experience in developing financial projections, especially for technology companies targeting international markets. - Proven Track Record: We are looking for someone who has a strong background in creating successful g...
J'ai besoin d'aide pour finir le design d'un site web, j'ai eu une super mauvaise expérience avec la compagnie qui a créer mon site web, ils m'ont remis un travail à moitié, je n'arrive pas à changer les photos moi même.
...specific city, state, and country, delving into neighborhood-level and county-level details. Key Requirements: - **Geo-Targeting:** The report should provide a detailed understanding of the demographics and market behavior of the specified locations. - **Competitor Analysis:** This will involve a thorough investigation of the market, outlining the competitive landscape and the strategies employed by competing businesses. - **Customer Behavior Data:** I would like the report to include detailed insights into customer behavior in the target locations. The ideal candidate for this project should have: - Proven experience in conducting geo-targeting reports. - Strong data analysis and interpretation skills. - Ability to gather, analyze and present competitor and custo...
I am looking for a skilled programmer who can adjust my self-developed trading strategy on TradingView into a system that can place limit orders on the trading platform, currently its market orders. Key Requirements: - Take the signals generated by my proprietary trading strategy and convert them into actionable limit orders. I need this project completed as soon as possible. This needs to happen so as to sent webhooks to ninjaview which sends them to ninjatrader
I'm in need of a sales representative who will focus only on the local geographical area of my lawn care business. The ideal candidate will be responsible for not only developing and maintaining relationships with pot...area of my lawn care business. The ideal candidate will be responsible for not only developing and maintaining relationships with potential and existing customers but doing so with a specialized knowledge of lawn care services. Essential skills necessary for this role include: - In-depth knowledge of lawn care sales - Strong relationship-building skills - Effective sales strategies - Local market understanding Experience in both the lawn care industry and sales is desirable but not an absolute must if the candidate exhibits a strong understanding and passio...
...in the forex market in a zigzag pattern. - Pivot Indicator: It should also be able to calculate and mark pivot points based on the price action. - Customizable: The indicator should be flexible and adjustable to my specific trading strategies and preferences. - User-Friendly: It should be easy to use and understand for a trader, with clear visual markers and alerts. Skills and Experience: - Proficient in TradingView's Pine Script language. - Strong understanding of forex market dynamics, including pivot points and zigzag patterns. - Experience in developing custom indicators for trading platforms. - Ability to incorporate user-defined rules and preferences into the indicator. This project requires a developer with a deep understanding of technical analysis in...
I am in need of a door to door sales agent who can strate...agent who can strategically promote and oversee the sale of our non-alcoholic drinks line targeting adults aged 25-55 in physical retail stores. What I require: - Creative ideas to market non-alcoholic beverages. - Understanding of the tastes and preferences of adults aged 25-55. - Experience in promoting products in physical retail stores. - Proven track record in similar markets. Ideal skills/experience: - Marketing & sales strategy - Physical retail promotional tactics - Consumer behavior understanding among adults - Prior experience in beverage marketing Achieving a connection with our target market is paramount. If this suits you, please bid with a summary of your strategy and experience catering to ...
...that I own. Key Responsibilities: - Evaluate and determine the market value of each domain - Create compelling listings for each domain, highlighting their potential value and target buyers - Promote the domains across appropriate platforms to maximize visibility - Handle negotiations with potential buyers and finalize domain sales Ideal Skills and Experience: - Proficiency in domain flipping or a related field - Strong understanding of the domain market and what makes a domain valuable - Excellent written communication skills for creating persuasive listings - Experience with online sales platforms and negotiating sales - Proven track record of selling domains at a good price and within a reasonable time frame This project is ideal for someone who is a seasoned...
I'm in need of a comprehensive business plan, specifically tailored for my p...of a comprehensive business plan, specifically tailored for my precision agriculture venture. - **Objective**: The main focus of this business plan is to outline the business goals and strategies. - **Industry**: The project is in the precision agriculture sector. - **Specific Goals**: * A key goal of this venture is offering a cost-effective agriculture drone capable of carrying up to 250lb. Ideal freelancer for this project should have: - Proven experience in writing business plans, especially within the technology or agriculture industry. - Ability to conduct market research and provide detailed industry analysis. - Excellent communication skills to effectively articulate the...
I'm seeking a professional experie...a professional experienced in algo trading in the stock market to manage my trading position. Knowledge and expertise in the following areas would be beneficial: - Day Trading: Your main focus should be on day trading strategies. Your ability to stay ahead of real-time news and trends is essential in securing high yield returns. - Moderate Risk: While I'm open to a moderate level of risk to achieve my day trading investment goals, it's crucial to maintain a strong stance on risk mitigation strategies. Professional favorites in financial markets, trading algorithms, and risk management under medium-risk settings would be an excellent fit for this role. Please share any similar previou experience or successes within the stock m...
I need two stand-up banners designed for my jewellery business. The theme should be centered around elegance and sophistication. The banners will be used for promotional purposes at an upcoming event. Key Requireme...Partner BIG Swarovski Logo at bottom website: Instagram Handle: mehrozdesignerjewellery 2nd Banner: NEO Restaurant Logo Now Home of Mehroz Designer Jewellery Logo Discover Mehroz Designer Jewellery: Innovative Silver Creations with Precious Gemstones, Swarovski Crystals, and Lab-Grown Diamonds. Custom Gold Jewellery in 21, 22, and 23-Carat Gold – Guaranteed to Beat Market Prices and Quality! at bottom website: Instagram Handle: mehrozdesignerjewellery Please provide examples of your previous similar work when applying.
Comprehensive Business Plan & Market Research
I'm in need of a professional designer to create a 24-page A5 booklet for my estate agency. I want the design to be traditional and elegant...to include information on local property values in the booklet. This is crucial for potential clients who are interested in the real-estate market in our locality. Skills and Experience: - I expect the designer to have experience in creating similarly styled elegant and traditional designs. - A good understanding of the real-estate market or experience in designing for estate agencies would be a plus. - The designer should be able to translate information on local property values into a visually appealing and engaging format. If you think you're up to the task, I'm eager to view your portfolio and hear your ideas on ...
I am looking for a photographer with experience in product photography. There are two aspects to this project - 1. educate me on the art of product photography using the equipment I have available to me and 2. photographing products. The applicant should be highly creative and able to suggest original ways to photograph products to be eye-catching and appealing to shoppers in a highly competitive market. Initially this will be a one or two-session project at my location however there is ample opportunity for future work taking photographs for me when I either 1. don't have time or 2. just don't want to do it. The option to take photos offsite is acceptable. This person should be able to capture the essence of a diverse range of products, including jewelr...
As a Business Development/Sales Partner, I'm seeking a dedicated individual to help me forge...beneficial. You should also be a motivated self-starter with excellent communication skills. Key Responsibilities: (Business Development Executive) (with good track record) + Must have strong Sales Managerial Experience in any B2B SaaS company OR been as a Sales Partner. + Experience in dealing with B2B + USA Market + Must be interested in taking on new challenges. + Should have hands-on experience. + Only Freelancers are Allowed (No Agencies or No Companies) Fixed Price Project: $3000 / Project This role is a great opportunity for an enthusiastic individual looking to gain experience in the finance industry and B2B sales while helping a SaaS startup grow. Only r...
...create a custom Chartink scanner designed specifically for equities. It should provide real-time and historical data analysis capabilities. Key Requirements: - Equities Focus: The tool should be optimized for stocks and securities. - Real-time Data Analysis: I need to stay on top of market movements as they happen. - Historical Data Analysis: Analyzing past data is crucial for spotting trends and making informed decisions. - Potential Stock Trends: The tool should help me identify potential trends in the equities market. - Trading Opportunities: I want to be able to use the output to identify profitable trading opportunities. It's important that the tool is user-friendly, efficient, and reliable. Experience in developing financial tools or trading platforms is highl...
...and refreshing our current designs to ensure consistency and relevance in the market. I am looking for a team that can accommodate the following: - Daily deliverables: We anticipate requiring new designs on a daily basis, hence your team must be able to commit to this frequency. - High quality work: Our expectations are high, and we need a team with a proven track record of delivering excellent design work, both in terms of aesthetics and functionality. Ideal skills and experience: - Proficient in Graphic, Web, and UI/UX design - Prior experience with both creating new designs and updating existing designs - Strong portfolio demonstrating a variety of design styles and projects - Excellent communication and project management skills - Ability to work efficiently under ti...
...exploring different color schemes, with a preference for a mix of black and white, blue and white, and green and white. - The selected freelancer will need to have a good understanding of the market and should be able to deliver a design that stands out in the industry. - Experience with logo design for established businesses is a plus. Please provide samples of your previous work that showcase your skills in this area. - The design should be unique, modern, and memorable. - The selected freelancer will need to be responsive to feedback and able to make revisions if required. - Timely delivery of the project is crucial. The the person is a Doctor For the following Psychology - psychotherapy - mental health - weight management - eating disorder - obesity - we...
...comprehensive analysis of the company's financial performance, market position, sustainability practices, enterprises value, and strategy. Your analysis should provide thorough insights into these areas, helping us understand the company's strengths, weaknesses, opportunities, and threats. Key requirements: - Evaluating Financial Performance: I need a detailed analysis of the company's revenue, profitability, cash flow, and debt levels. Your insights here will be crucial in understanding the company's financial health and stability. - Assessing Market Position: You should gather data on the company's market share, conduct a competitor analysis, and evaluate customer perception. This will help us understand how the company is positioned in t...
I'm in the process of establishing a book store that primarily focuses on Business and Self-Help genres. I'm aiming for a modern and sleek name that will appeal to young adults. Key Points: - We're looking for a name that's succinct and easy to remember - It should convey a sense of innovation and contemporary style - The name should resonate with young adu...of innovation and contemporary style - The name should resonate with young adults, our target audience - The name should subtly suggest that we focus on Business and Self-Help genres - The name should be available for domain registration and not infringe upon existing copyrights Ideal Freelancer: - Experience in branding - Knowledge of current trends in naming - Understanding of the young adult market - C...
... Key Concerns: - Market Analysis and Positioning: I'm looking for someone who can delve deep into the market, identify our target audience, and pinpoint our unique selling points. - Financial Planning and Projections: I need an expert who can create a detailed financial plan that reflects our current financial situation, and provides projections for growth. - Operational Structure and Processes: The ideal candidate will be able to help me create a sustainable operational structure that ensures smooth running of the business. Target Market: I'm looking to cater to a wide range of individuals including children, adults, and elderly individuals with disabilities. It's important that the business plan reflects how we can effectively reach and serve the...
I'm in need of a specialist capable of developing a moving average indicator in AFL. It needs to be customizable with these specifications: 1. Selection Method: The ability to specify moving average parameters such as Time Periods, Vertical Shift %, Horizontal Shift, Price Field, and Method 2. Adjustable Parameters: For the moving average, I want to...to edit parameters including Time periods, Vertical shift %, Horizontal shift, Price field, and Method. 3. Time Frame: It needs to accommodate a wide range of time periods from 0 to 1000. This requires proficiency in AFL, understanding of moving average indicators and excellent attention to detail to ensure the varying parameters can be edited seamlessly. A familiarity with finance and stock market indicators will certainly b...
...Strategies & Planning: - Conducting thorough market research and analysis to identify opportunities and risks. - Competitor analysis to develop strategies that differentiate us in the market. - Sales forecasting to set realistic targets and allocate resources efficiently. - Sales Team Management: - Tracking and managing the performance of our sales team using CRM software. - Utilizing spreadsheets for detailed performance metrics and analysis. - Integrating project management tools for streamlining our sales operations. Ideal candidates for this project should have: - Proven experience in sales strategy development, planning, and execution. - A strong background in sales team management. - Proficiency in CRM software, spreadsheets, and p...
I'm looking to establish a new business in the Food & Beverage industry. I'm still in the...new business in the Food & Beverage industry. I'm still in the ideation phase, so I need help with the following: - Conducting Market Research: Understanding the current landscape, identifying trends and potential gaps in the market. - Crafting a Business Plan: I need a comprehensive business plan that includes a clear vision, mission, and a strategy for sustainable growth. - Financial Projections: Creating realistic financial projections that will help me understand the financial viability of the business. Ideal freelancers for this project should have experience in the food and beverage industry, have previous experience starting a business, and be ski...
I'm in the market for an EDI professional to assist with the implementation of our EDI system. This freelancer should have a deep understanding of Electronic Data Interchange (EDI) along with ample experience in its implementation. Key tasks include: - Data Mapping: A core aspect of this project will be to ensure efficient data mapping across our EDI system. This requires a solid grasp of data structures, formats, and flow within EDI. - Partner Setup: You'll be involved in setting up our EDI partners, ensuring seamless communication and transactions between various entities. This project is focused on the implementation phase. Ideal candidates will have prior experience in the successful implementation of EDI systems. You should be adept at identifying and ...
I'm seeking skilled virtual business development officers who can help take my Extrusion Die Manufacturing business to th...Communication Skills: Strong verbal and written communication skills are a must for this role. You should be comfortable making sales calls and negotiating contracts. - Industry Knowledge: Understanding of the technology and manufacturing sectors, particularly in the context of Extrusion Die Manufacturing, is a big plus. - Results-Driven: The primary goal of this role is to increase sales revenue, expand market reach, and develop strategic partnerships. You should be highly motivated to achieve these objectives. If you have experience in B2B sales in the technology and manufacturing sectors, and a proven track record of delivering results, I would love to...
I am creating profile cover photo for freelancer.com! Are you really creative? Create for me!
I'm in ne...views, and the surrounding environment. - The primary goal is to market the property effectively, so the video should be visually appealing and professional. - Since it's a longer video at 5 minutes, it's important to maintain viewer engagement. Ideal skills and experience: - Proficiency in 3D architectural visualization and animation - Previous experience with creating marketing videos, particularly in the real estate sector, would be a significant advantage - The ability to work with the provided content (interior details, exterior views, and surrounding environment) and transform them into an engaging video Looking forward to working with a talented 3D artist who can bring creativity and technical expertise to this project. Note: i want min...
I'm looking for a sales representative based in the MENA Region to help promote our Active Pharmaceutical Ingredient (API) business. Key Responsibilities: - Focusing on countries including Saudi Arabia, UAE, Egypt, Morocco, Algeria - Prioritizing efforts in Saudi Arabia, UAE, Egypt, and Morocco - Assisting in increasing sales and market presence - Establishment of new partnerships - Promotion to local B2B clients - Support in order procurement Ideal Candidate: - Proven experience in pharmaceutical sales - Deep understanding of the MENA region - Strong sales and negotiation skills - Existing network within the pharmaceutical industry - Excellent communication and interpersonal skills
I am creating profile cover photo for freelancer.com! Are you really creative? Create for me!