Rdp client control vb punët

...as in I could literally mock up sites in illustrator and then it would be just a matter of building them as is, if that is an option that would make our workflow more efficient. Things I would l need from the right person: 1. An eye for details. A lot of our communication towards the end of completion on each site would be in regards to small fine elements of the sites as I want the quality control of our output to be high. 2. Ideally I would like to work with someone who has ideas of ways we can make the work even better but my main goal is to find someone at this stage who is simply capable of building something what the clients need. 3. I would want to work with someone who has a knowledge of seo and anything else that would enable to give our clients the best chance o...

asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.

... We are a dynamic freight forwarding company seeking a skilled sales specialist to spearhead our client acquisition efforts. The ideal candidate should possess excellent English communication skills, both written and verbal. Initial tasks will include creating a LinkedIn company page and generating compelling content using tools like Photoshop to enhance our online presence. Responsibilities: LinkedIn Company Page Creation: Develop a professional LinkedIn company page that effectively showcases our services and engages our target audience. Content Creation: Produce captivating visual content using tools like Photoshop to accompany our posts on LinkedIn and other social media platforms. Client Acquisition: Proactively reach out to potential clients who require transportat...

...including form submissions that trigger deal creations and associate contacts. - Develop and manage workflows and lifecycle drip email campaigns tailored to different client needs. - Oversee the creation and analysis of custom reports for diverse clients. - Manage sales pipeline visualization and adjustments for various projects. - Train team members on advanced HubSpot functionalities for a range of scenarios. - Ensure seamless data synchronization across connected applications for all clients. - Configure and manage HubSpot chatbots as per client requirements. - Implement SEO strategies within the HubSpot environment to meet diverse client goals. Requirements: - Minimum of 3-4 years of experience as a HubSpot Administrator. - Proven ability to manage multiple pro...

As the project owner, I require an Arduino Uno code, specifically designed to interact with a fingerprint reader for input, LCD and 14 relays for output. Key Requirements: - The code should ...people's fingerprints (let's say 2 different fingerprints for each person), write the name of that person on the LCD and activate the corresponding relay for each person. - The associated relays will control a particular robotic device. - When an unrecognized fingerprint is scanned, the system should write on LCD "unrecognized fingerprint" without triggering any relay. Ideal Skills and Experience: - Proficiency with Arduino programming - Experience working with fingerprint readers - Knowledge of relay and robotic systems . Familiarity with sensor integrations and their...

I am about to start a Copywriting Business, and I wanted help setting up a Website to market my services. - I am completely fine with using a template - I will write the copy - I want the website to be easy to customize and change over time - I want complete control over the backend - I'm open to using WordPress, Ghost or any other CMS that makes sense.

...for suppliers to manage products, process orders, and handle cancellations efficiently. Admin Backend: Construct a robust admin panel to oversee order processing, site settings, and overall platform management. System Overview: Showcase popular services through a slider on the front end, adjustable by the admin. Customize service display based on date, name, or cost, with admin control. Implement a commission structure for admin's revenue, configurable via the admin panel. Key Features: User Authentication and Registration Product/Service Listings with Descriptions and Pricing Search and Filter Options Shopping Cart and Secure Checkout Process Comprehensive Order Management User Reviews and Ratings Personalized User and Supp...

I'm seeking for a talented architect with strong experience in designing modern residential houses. Your role will be to develop an innovative yet functional design that fits with our aesthetics. Key Responsibil...functional design that fits with our aesthetics. Key Responsibilities: - Develop architectural designs for a new modern house - Provide a coherent and visually appealing design layout - Collaborate closely with me for inputs and adjustments Ideal Skills and Experience: - Proven experience in modern residential architecture - Strong attention to detail - Good communication and understanding of client needs Please attach your relevant portfolio or examples of previous work in your proposal. I look forward to working with the ideal designer who can bring my visio...

...like this script to be rewritten for MacOS using Python. In order to ensure that the MacOS script is as close as possible to the original Windows script, the sound functionalities need to be replicated exactly. Key Skills Needed: - Proficiency in Python - Experience with MacOS scripting - Understanding of AHK (previous experience with this language would be beneficial) - Proficient in sound control within scripting The ideal candidate for this role would be someone who has a good understanding of AHK and Python, and is able to adapt the sound functionality of the AHK script to MacOS, while keeping the original features and functions of the script intact. $Numpad2:: If (toggle1) { Send {v up} toggle1:=!toggle1 ; or false, but we started with toggle1 is true, so this should b...

I am looking for a skilled designer who can help me make some edits to a design for a client. - I need the wings in the logo changed to flames and the wording of the subtitle to be edited to say Emergency Services. - The design should look cohesive and professional even after these changes. - The flames should be fully integrated into the main logo, not just as a decorative border or background element. This job requires someone with: - Proficiency in graphic design, especially in creating and editing logos - Experience in typography and layout design - The ability to understand and work with visual elements in a design. If you have these skills, please submit your bid.

...comprised of industry veterans, Confirmis's business model is designed to overcome perennial lack of data (let alone quality data) to support effective decision-making, particularly in developing economies. As a Site Verifier, you will be responsible for verifying a company’s existence through visual data by conducting a site visit to ensure that we provide reliable and accurate information to our client. JOB DESCRIPTION: • Conduct basic verification with the subject company’s authorized representative, such as line of business, key executives' names, etc. • Take pictures of the subject company and its vicinity, as per Confirmis’ standard operating guidelines. • Provide observation about the company to gauge activeness, e.g., staff work...

I'm in need of a talented graphic designer who can create a modern and sleek flyer. The focus of the flyer is to provide information about my business, so it must effectively com...include essential information about my business, so the design should be conducive to clear and effective communication Ideal Skills: - Strong graphic design skills and experience in creating professional business materials - Proficiency in using design software for creating flyers - Ability to understand and work with brand guidelines and color schemes - Good communication and understanding of client requirements The project requires a designer who can not only interpret my brief accurately but also bring a creative touch to the final design. If you can bring all these skills together, I'd lo...

...to meet my needs. The software must be compatible with Windows and should include: - Credit Score Tracking: A feature that allows constant monitoring and updating of credit scores. - Dispute Management: A functionality that simplifies the management and tracking of credit report disputes. It should allow me to file, monitor, and manage disputes easily. - Client Management: A robust client management system to effortlessly manage client profiles, credit statuses, and communication. Ideal candidates should have prior experience in building similar software, and a deep understanding of how credit repair systems run. Proficiency in Windows software development will be necessary. Integration options weren't specified but the ability to build software with pote...

I have a project that requires setting up an 8 Channe...requires setting up an 8 Channel Arduino Relay Module and programming it to operate using a basic 4 button hand controller. My Arduino board of choice is the Arduino Uno. For the hand controller, I need different functionalities: - Each button should be able to toggle a specific relay on and off. - Certain buttons should cycle through a sequence of relays. - Some buttons should have the ability to control a combination of relays. Importantly, only 1 relay should be controlled at a time. The ideal freelancer for this project should have a deep understanding of Arduino programming, particularly with Arduino Uno, and experience with relay modules and controller setup. Familiarity with creating flexible, customizable controls ...

...experience in client acquisition - Proficiency in communication and negotiation - Familiarity with the York Region, Ontario, Canada area is a plus Your main tasks would include: - Researching and identifying potential clients in York Region - Contacting clients via email, phone calls, or in person (door-to-door) - Convincing clients to book our residential window cleaning services - Keeping track of and reporting on client acquisition progress Free Trial Opportunity: As part of our hiring process, we're offering a free trial period to assess your ability to generate recruited houses effectively. During this trial period, you'll be tasked with acquiring 2 new clients closed and scheduled for a minimum of $200 each. If you have trouble quoting or providing an es...

...Responsibilities: - You will be solely focused on B2B sales, targeting sectors such as food and beverage, retail, wholesale distribution, wine shops, butcher shops, gourmet shops, cafes, delis, and similar businesses. - Your main goal will be to establish and maintain strong client relationships to secure recurring sales. Experience and Skills Required: - We are specifically seeking sales professionals with experience. - Proven expertise in B2B sales is crucial. - A track record of achieving targets and fostering long-term client relationships. - Experience within the food and beverage industry is highly advantageous. Compensation: - We offer an attractive commission of 30% per sale, making this an excellent opportunity for sales professionals who deliver results. ...

...comprised of industry veterans, Confirmis's business model is designed to overcome perennial lack of data (let alone quality data) to support effective decision-making, particularly in developing economies. As a Site Verifier, you will be responsible for verifying a company’s existence through visual data by conducting a site visit to ensure that we provide reliable and accurate information to our client. JOB DESCRIPTION: • Conduct basic verification with the subject company’s authorized representative, such as line of business, key executives' names, etc. • Take pictures of the subject company and its vicinity, as per Confirmis’ standard operating guidelines. • Provide observation about the company to gauge activeness, e.g., staff work...

We are seeking a highly skilled PCB designer to develop a custom board featuring the RP2040 microchip to control multiple DC motors and MOSFETs, with integrated voltage regulation. This project requires expertise in high-power applications, voltage regulation, and serial communications. Project Requirements: Microcontroller: RP2040 chip to manage all operations. Power Handling: Board must handle input of 24V. Voltage Regulation: Conversion of 24V input to 12V and 5V outputs. MOSFETs: 5 MOSFETs for 24V, 7A control. 4 MOSFETs for 12V, 5A control. Communication: USB Type-C for robust serial communication. Inputs and Outputs: 2 analog inputs. 1 One Wire communication interface. Additional pins for digital input/output as required. Deliverables: Complete PCB design files...

Seeking an Android developer with expertise in Kotlin and XML for a video display app project. Must integrate a specific HLS video stream (":ktvaq.stream.smil/chunklist_b350000_t64MjQwcA==.m3u8") into an XML fragment. Key functionalities needed: Play/Pause, volume control, and adjustable video speed. Autoplay after a delay. Full screen and landscape mode support. Requirements: Profound experience in Android development, especially in handling video playback and media controls.

We are part of a worldwide network providing drug testing services. We have a presence in multiple countries. Our client wants us to conduct drug testing around Gifu, TAKAYAMA, Japan, 506-0012. We will reimburse you for your travel. We will train you on how to do it and provide the necessary supplies and tools. You will have to either go to the client's residence or office to collect the provided urine sample or rent a meeting room to host the session. Meeting room rental costs will be borne by us. Thereafter I will guide you on how to perform the testing hygienically and you will send us the result. We will compensate you for every test done.

I'm looking for a Control Engineer with proficiency in Matlab to help with a project focused on modeling and simulation. The primary goal of this project is to optimize the performance of a system. Key requirements and responsibilities: - Expertise in modeling and simulation within Matlab - Background in control engineering - Ability to analyze and understand system behavior - Create and implement strategies to enhance system performance - Strong communication skills to collaborate on project goals and updates While the type of system to be optimized hasn't been specified by the client, experience with mechanical, electrical, or hybrid systems would be a plus. Your expertise will be crucial in ensuring the successful optimization of the system.

Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.

...cover the resolution of critical incidents (service outage) in this time slot. • The committed SLA, for this time slot, will be 3 hours from the report sent from our Help Desk. • The service must contemplate 7 x 24 monitoring of the platform with an alarm system to detect service outages. This capacity will allow an event to be anticipated, from the moment it occurs, without notification from the Client....

...this goal, we'll consider offering you a permanent position with our team. The leads must be generated in the area of Canada, Ontario more specifically York Region. Leads must be generated from the following cities: - Markham - Richmond Hill - Vaughan - Woodbridge - Scarborough - Newmarket - Aurora - King City - Stouffville - North York Ideal Candidate: - Proficient in lead generation and client conversion, with a keen eye for suburban residential areas. - Excellent communication skills, particularly in phone calls. - Prior experience in sales, marketing or customer service that can be applied to the window cleaning industry. - Proven track record of increasing sales through lead generation. - Familiarity with email marketing and direct mail approaches is a plus, th...

I am in need of a skilled backend developer with expertise in JavaScript and specifically Node.js. The project you'll be working on is focused on building an API. Key Requirements: - Proficiency in JavaScript and Node.js - Significant experience in building APIs -...and ability to work independently It would be a bonus if you also have experience with: - - Any other relevant backend technologies Please note that you will be working solely on the backend part of the project, so an understanding of RESTful API design principles is vital. Your responsibility will be to handle requests from the frontend, process data, and send responses back to the client. If you're a backend developer with a knack for problem solving, this could be a great fit. Looking forward to hearing...

...metrics. Create a customizable dashboard that allows users to adjust and configure according to their preferences and needs. Alerts and Notifications Management: Implement alerts, toasts, and modals to enhance user interaction and the presentation of critical information or errors. Develop functionalities for general announcements, both internal from the company and communications directed at client companies. Multi-company Functionality: Provide robust functionality for changing companies within the platform, specifically designed for administrators and users with multiple roles. Required Skills and Qualifications: Proven experience working with React.js and Next.js. In-depth knowledge in API integration and error handling in web applications. Ability to implement advanced UI...

As a client deeply involved in the healthcare sector, I urgently require a highly skilled and experienced legal expert to comprehensively review a purchase contract for a healthcare facility. More specifically, my attention is geared towards: - Legal obligations: The contract entails certain legal obligations that need a professional eye for correct interpretation and guidance. This way, I can save myself from falling into potential legal pitfalls. - Asset purchase agreements: Given the importance of the asset purchase agreements in this particular contract, it is essential that an expert helps in understanding the specificities, especially in terms of potential liabilities associated with the assets. The ideal candidate should have a profound understanding of laws governing ass...

I'm looking for a proficient sales representative to sell my services. Mandatory Skills: - Exceptional customer service - In-depth technical knowledge - Superior negotiation skills - Perfect English and Spanish is a must! Compensation Strat...English and Spanish is a must! Compensation Strategy: The chosen representative will be paid on an hourly basis. Experience in selling services is a must, as they will need to convincingly communicate the value of our offerings. The ideal candidate should be able and ready to handle client inquiries effectively and meet the sales objectives. You must be able to thrive in customer service, possess technical knowledge, and have leading negotiation skills. Your experience will reflect your understanding of client needs and help me...

...custom informational site with a user-friendly To-Do List plugin. The site is aimed at the general public, for informational purposes currently and visually appealing. Key Requirements: - Wordpress Development: Proficiency in creating and customizing websites on the Wordpress platform is a must. - To-Do List Plugin: The plugin should allow task assignment to users. That can sync with an App Based client. i'll let developer suggest such a good program to utilize. It will give push notifications and support moving the date/time and allow re-occurring tasks, and assigning the task to users. Your Responsibilities: - Design: I need a simple, clean and modern design that will appeal to a wide audience. - Functionality: The to-do list should be easy to use, intuitive and allow as...

I'm seeking a skilled individual to take over the maintenance and day-to-day operations of my hydroponic system + training staff and handing over after initial setup. The tasks include: - Watering & Nutrient Monitoring: Ensuring plants receive adequate water and nutrients, adjusting as needed. - pH Level Management: Regular monitoring and adjusting for optimal growth. - Temperature Control: Checking and maintaining temperature settings. - Harvesting & Replanting: Timely harvesting and replanting as per the growth cycle. The ideal candidate should have: - Strong background in hydroponics - Proficiency in nutrient and pH management - Experience in managing lighting and temperature settings - Proven track record in harvesting and replanting in hydroponics - Ability to ...

...for suppliers to manage products, process orders, and handle cancellations efficiently. Admin Backend: Construct a robust admin panel to oversee order processing, site settings, and overall platform management. System Overview: Showcase popular services through a slider on the front end, adjustable by the admin. Customize service display based on date, name, or cost, with admin control. Implement a commission structure for admin's revenue, configurable via the admin panel. Key Features: User Authentication and Registration Product/Service Listings with Descriptions and Pricing Search and Filter Options Shopping Cart and Secure Checkout Process Comprehensive Order Management User Reviews and Ratings Personalized User and Supp...

I'm currently experiencing an issue with my SSL certificate on my personal blog. The SSL certificate is showing an error message and I need a professional to fix this promptly. Key Responsibilities: - Identify the root cause of the SSL error message - Fix the SSL certificate issue to ensure it's working correctly - Test the SSL certificate...certificate is showing an error message and I need a professional to fix this promptly. Key Responsibilities: - Identify the root cause of the SSL error message - Fix the SSL certificate issue to ensure it's working correctly - Test the SSL certificate to confirm it's functioning well Ideal Skills: - Proven experience in fixing SSL certificate errors - Strong understanding of web hosting control panels - Expertise in ...

I'm seeking a creative designer to create a unique and engaging logo for my cosmetics brand, "Sue - beauty". The design should mainly utilize the colors black, white and have a subtle touch of gold or a beautiful brown. Although I don't have a specific symbol in mind as I trust the designer's expertise and creativity, the logo should embody the...white and have a subtle touch of gold or a beautiful brown. Although I don't have a specific symbol in mind as I trust the designer's expertise and creativity, the logo should embody the elegance and sophistication of the beauty industry. Proficiency in graphic design and previous experience with cosmetic-related design projects would be beneficial for this project. I put a model of the sample the client ...

...- A dynamic platform for sign-up as a tenant or owner with verification through email and mobile SMS code systems. - Email notification system, alerting after successful property listing and routing responses to the website admin. - An interactive admin dashboard showcasing all listings and consequent requests with daily and monthly statistics. - An invoice generation system. - A comprehensive control system for the admin to manage users and finances. For Tenants: - An intelligent search system for properties. - An integrated platform for making bookings and facilitating payments. The ideal candidate should have experience in creating similar platforms and proficient at writing an elegant, clean code. Understanding users' actions and needs should drive your design process...

I'm in need of a skilled Unity Developer who can create an engaging hypercasual infinite runner game. The game should be designed for both iOS and Android platforms. Key requirements for this project include: - Developing a Cartoonish 3D art style for the game. - Implementing power-ups as a key mechanic. - Implement an infinite runner game, where you control a tank/car and have to avoid incoming obstacles and enemies. - Player should die upon hitting the obstacle - There should be a results screen with earned in-game currency. The ideal freelancer should have: - Proven experience in developing hypercasual games. - Strong grasp of Unity development. - Experience with Unity Gaming Services. - A portfolio that showcases previous mobile game projects. Please include samples of ...

I'm seeking an expert SharePoint developer to create a comprehensive solution for my company. We aspire to establish an efficient document management system, streamline our workflow automation, enhance collaborative tools, and set up intranet, internal websites. Key Features: - Document Management: The system must offer us precise control over our documents, storing, organising and managing them effectively. - Workflow automation: The SharePoint solution should provide a platform where routine tasks are automated, improving efficiency in our business processes. - Collaboration tools: The system should enhance our team collaboration making work more flexible, organised, and productive. - Intranet & Internal websites: We require a system that allows for effective commun...

...application. I'm interested in your expertise in managing containerized applications, ensuring they can scale effectively, and maintaining a high level of security. Key Tasks: - Containerization: Implementing the best containerization platform based on your experience. - Scalability: Designing a solution that can easily scale and handle increased loads. - Security: Ensuring network isolation, access control, and secure image signing are properly implemented. Ideal candidates should have: - Strong experience with containerization platforms like Docker Swarm, Kubernetes, or Apache Mesos. - Proven expertise in designing and maintaining scalable architectures. - A comprehensive understanding of security principles specific to containerized applications. Your insights and reco...

I'm in need of a skilled Java developer to build an Android app for me. Essentially, I have a code that I'd like to transform into a user-friendly, medium complexity application. It should allow me to input values straightforwardly, and upon entry, it ...with Android platform - Pay attention to details and put user experience in front of everything Ideal Skills: - Solid experience with Android development using Java - Proven track record in creating user-friendly applications - Exceptional problem-solving abilities, specifically with data input and calculations - Strong focus on user experience design and simplicity - Familiarity with source control systems and agile methodologies If you have the required skills and experience, I'm looking forward to discussing my ...

...Plumbing, Electric, General, HVAC. I would further like to be number 1 for searches in the state of Florida for commercial signage, Parking lot lighting and Facilities Maintenance. I don’t know if this is initially achieved through paid search coupled with SEO and SERPs (this is by far not my field). I also want to include click to call, quick contact forms, and chat along with an estimator, client portal and possible booking calendar. Once you have read and understand this please send a msg that summarizes and explains how you can support this project include the dynamic piece based on geo location. I also require the ability to communicate during US EST 10AM to 5PM. Our current clients are large restaurant chains, hotels, car dealerships, banks, retail, etc…. ...

We are in need of a highly skilled Laravel expert team to continue development on existing ...- Extensive experience in Laravel development - Proficiency in Laravel customization and optimization - Strong understanding of Gitlab - version control !* - Strong understanding of web development principles and best practices - Ability to work on a large-scale project and deliver high-quality results - Excellent problem-solving skills and attention to detail - Database Design & Management: The ability to design and manage a highly organized, efficient database is crucial. Skills that would be beneficial: - Thorough Laravel expertise - Proven track record in creating reporting and analytics solutions !!!*** - Understanding of Git version control - Proven track record in creatin...

We are an Agency, in search of a proficient mobile app developer to create a cross-platform application for internal task management, similar to Google Tasks. This application will serve as a pivotal tool within our client company, facilitating seamless task assignment, tracking, and communication between manager and employees. Project Overview: We require a user-friendly mobile application that enables managers to assign tasks, monitor their progress, and receive notifications upon completion. Additionally, employees should be able to update task statuses and notify managers when tasks are finished. Key Features: User Authentication: Secure login functionality for managers and employees. Task Assignment: Managers should be able to create tasks, assign them to specific employees, ...

Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.

...Card Payments: Provide a secure payment gateway for users to make transactions using their credit or debit cards. - PayPal: Integrate PayPal as a payment option, ensuring a convenient and familiar method for users. - Bank Transfer: Offer bank transfer as an alternative payment method, accommodating users who prefer this option. User Roles: - Admin: Develop a comprehensive admin panel with full control over the website, including user management, content moderation, and more. - Registered Users: Implement features that enhance the user experience for those who have registered accounts. - Guest Users: Allow non-registered visitors to access certain features of the site, while encouraging them to sign up for full access and benefits. To successfully complete this project, you shou...

...clientes hasta la generación de órdenes de venta y seguimiento de pagos. Facturación: Desarrollo de funcionalidades para la generación automática de facturas conforme a la regulación ecuatoriana de impuestos, incluyendo la gestión de retenciones y notas de crédito. Inventario y Bodega: Configuración de un sistema de inventario que permita gestionar el stock de equipos y materiales, así como el control de entradas y salidas en bodega. Compras: Integración de un módulo de compras para gestionar el proceso de adquisición de productos y servicios necesarios para la operación del ISP, incluyendo la gestión de importaciones. Contabilidad: Desarrollo de funcionalidades contables ...

As a client, I'm seeking the assistance of an experienced blockchain developer to help with the creation of a decentralized finance (DeFi) platform on Solana SPL Token. Key Project Requirements: - Creation of a functional, robust DeFi platform. - I am open with regard to the specific features of the platform since this was not specified during our discussions. The abilities of providing liquidity pools, yield farming, lending and borrowing facilities are welcome. - I have a design and branding concept in mind, which would be provided to help maintain the aesthetics and user-interface of the platform. Preferred Skills and Experience: - Extensive experience in blockchain development, particularly on the Solana network. - A solid understanding of SPL token and decentralized ...

NEED URGENT AND WILL HIRE NOW I need a seasoned Laravel developer to introduce custom fe...API integrations to efficient database management. I am particularly focusing on enriching the user interface design, and advancing client and case management aspects of the system. The improvements I'm envisioning include but are not limited to innovative UI design adaptations and seamless client management solutions. Although the specifics for the required client management functionalities weren't designated, your expert opinion on the undeniable essentials based on your experience with similar projects would be highly valued. Ideal candidates granularly understand Laravel and its best practices, have a knack for elegant UI design, and have experience in client...

I'm in need of a developer to create a custom healthcare information system for managing patient ...dosage, and instructions. System Preferences: - Cloud-Based: I prefer a cloud-based system for storing research laboratory results and patient consents. This will allow for easy access and sharing of data. - Role-Based Access Control: The cloud-based system must implement role-based access control. This is crucial for ensuring that only authorized personnel can access and modify sensitive information. Ideal Skills: - Experience in developing healthcare information systems. - Proficiency in cloud-based system development. - Strong understanding of role-based access control. - Blockchain sandbox is available If you are confident in your ability to meet these requi...

...creating a backend dashboard for user management - Ability to creatively design a user interface targeted at young football enthusiasts - Proficiency in both English and Arabic languages, with exceptional understanding of cultural nuances in app designs Key Features: - Player Registration: The app should allow players to register, manage their subscription, and access important updates. - Admin Control: I require a backend dashboard for managing subscriptions and tracking user activities. - User-friendly Design: The app interface should be engaging, user-friendly, and cater to aspiring young footballers. Your responsibilities: - Coding, testing, and debugging applications. - Ensure the application is fully functional across multiple platforms (iOS & Android). - Implemen...