Sample word plugin vb punët
...customers solving problems with deliveries, tracking parcels online (EestiPost, Omniva, DPD, TNT, FedEx, UPS, etc…) handling issues reported by clients with products delivered, managing issues in case of delays, making orders modification, invoice modification, address modification, managing communication about returns, disputes, refunds, etc… Quality assurance: performing quality inspection of the sample of the products manufactured in order to escalate with factories possible faults and quality fluctuations issues whilst following up with customers who have been affected by production issues. Online technical support and troubleshooting: supporting customers when payment error occur, issuing credit card refunds, spotting technical errors and mistakes on the ...
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
Sample ghkjkjgkjgkjhgjkgjkgkjgjggkgjkgjkggjggjkgjgjkgjkgjkgjkgjkgjkgjgjgjgjgjkgkgjkgjgkjkgjkjgjgjkgkjkj
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
Need this 4 page document to be in word. As it is very important that each side (as there is an English side and a Spanish side) is part of table, as I need each side not to interact with the other (meaning that if I put text on one it does not affect the other side), I include a word "template" so its clear
*I am looking to fill a long-term editor position for multiple projects for my agency.* *I r... edit it and upload the edited videos in a separate folder. I expect a simple thumbnail that fits the ratio 1:1 on Instagram feed. All videos should be edited in 9/16 format for Fullscreen experiences on IG Reels + TikTok.* *Please reach out to me here or instagram (roman_marron) and tell me a bit about yourself, your current situation and show me previous work.* ***Important***: *I expect a sample to quality check your work, if I find qualified for the position, I will provide you with the raw 60-seconds footage.* *Fluent English is a must + you must be able to jump on a Zoom call to go through the onboarding process (webcam is a must).* *Daily reports are expected whenever we get to...
I need to convert a simple text-based PDF into a Word document for the purpose of editing the content. The original formatting of the PDF must be maintained in the Word document. Key Requirements: - Convert a simple text-based PDF into an editable Word document - Maintain the original formatting of the PDF - The purpose of this conversion is solely for editing the content, not for reformatting or extracting text for other uses Ideal Skills: - Proficient in both PDF and Word processing - Attention to detail to ensure the accuracy of the conversion - Understanding of the importance of maintaining the original formatting
Ho un grosso problema con il plugin WCFM - WooCommerce Multivendor Marketplace - Direct PayPal che al momento non consente pagamenti. Per quanto mi sembri di aver impostato tutto correttamente, i due venditori attualmente presenti non sembrano essere autorizzati a ricevere pagamenti. Il messaggio di errore ricorrente è “Please remove xxx from the cart to checkout, as the vendor XYZ is not able to receive payment via Paypal” (lo stesso avviene anche con l’altro venditore). Anche accedendo ai negozi dei venditori > impostazioni > pagamento, dopo aver inserito come metodo di pagamento ECFM PayPal Marketplace ed indicato l’email collegata a PayPal, se si fa Sign Up il messaggio è “Authorization failed due to insufficient permissions&rd...
I'm looking for a freelancer who can accurately convert a PDF file to a Word document, as I need to be able to edit the content. The project involves: - Converting a text-only PDF file to a Word document while maintaining the content's structure and flow. - Ensuring the Word document follows standard formatting, but with a focus on making the content easily editable. Ideal Skills: - Proficient in PDF to Word conversion. - Strong attention to detail to ensure accurate transcription. - Familiar with standard Word formatting. - Prior experience in editing content is a plus.
I'm looking to convert a PDF file into a Word format. The primary reason for this is to be able to edit the content. Key Requirements: - Convert a PDF (less than 50 pages) into a fully editable Word document. - Text should be easy to modify and manipulate. Since the conversion is solely for the purpose of editing, maintaining the exact format is not a priority. The primary focus is on ensuring that the content is accessible for editing post-conversion. Ideal Skills and Experience: - Proficient in PDF to Word conversions. - Strong attention to detail to ensure accuracy in the text conversion. - Experience with project of similar scale and scope will be a plus.
I'm exploring the possibilities of blockchain technology and need the assistance of an experienced C# developer. The task is to create a simple (SAMPLE) program using the NBitcoin library. This program will create a Bitcoin transaction, pushing data into both op_return and op_pushdata segments. I would want to be able to do it live or on testnet. Skills Required: - Proficiency in C# - Experience with the NBitcoin library. This task would involve mainly pushing simple text data for demonstrating purposes. Familiarity with manipulating both fixed and dynamic datasets is highly beneficial for this project. If you're an experienced C# developer with a solid background in NBitcoin and can easily complete this task, please reach out.
I need a skilled typist to meticulously transform my PDF document into an editable word file. Here's what this project entails: - Purpose: I aim to edit the content of my PDF, meaning accuracy is crucial to avoid having to make changes post-conversion. - Layout and Design: I want the Word document to mirror the exact layout and design features of the original PDF. This requires an eye for detail to ensure no elements are accidentally altered or missed. - Content Description: The PDF is text only, so no need to worry about images or complex graphical elements. Ideal skills are attention to detail, proficiency with Microsoft Word and PDF conversion tools, and excellent typing accuracy. Previous experience with similar projects is a plus.
I need a PDF file converted into a Word document. The source language of the PDF is English. The final Word document should be clear and legible, but I require some formatting changes to be made. This means the formatting will not be an exact replica of the PDF file. Project Requirements: - Convert a PDF file to Word and ensure the document is editable. - Maintain the text in English, but potentially adjust formatting. Ideal Skills: - Proficiency in English for content understanding. - Excellent skills in PDF to Word document conversion. - Understanding of different formatting options in Word and the ability to implement them. - Attention to detail to ensure accuracy and clarity.
I seek a professional experienced in handling Word documents effectively to execute a data copying project. Key Job responsibilities include: - Copying a collection of Word documents. - Applying simplified formatting to the copied documents, eliminating any surplus details while retaining crucial information. The ideal freelancer should have: - Proficient skills in Microsoft Word, with a special emphasis on formatting. - An eye for detail and an understanding of simplifying documents without missing out on vital data. - An ability to work meticulously and deliver within a determined timeframe.
I am seeking a coder proficient in Revit API, particularly in plugin development. Apparently, I am not specific about the Revit version being used, hence, the plugin must be developed in a way that is compatible across several recent Revit versions (2019, 2020, 2021). The primary objectives are: - Creating a tool within Revit that will automatically optimize rebar lengths. - Identifying and categorizing reusable rebar components. The ideal candidate will have experience in similar projects and a strong understanding of construction waste management, specifically rebar use. Since my present approach towards rebar waste management relies on experience-based estimation, your tool should replace this subjective method with an objective one, providing a more controlled, optimize...
I'm looking for an expert in both written translation from English to Swahili and voiceover work. The project involves about 8000 words. kindly respond with your voice sample. Key Responsibilities: - Accurately translate the text provided from English into Swahili - Provide a male voiceover for the translated script This work will be used for a business presentation, so it is crucial that the translation and voiceover are professional and of high quality. Ideal Candidate: - Fluent in English and Swahili - Previous experience in translation and voiceover work - Experience in business or corporate translations would be a plus - Excellent communication and presentation skills. Looking forward to receiving your proposals. Only native profiles please no agencies
I'm seeking a skilled freelancer to set up my website on WordPress from a provided Figma file. I have already purchased the domain name. The project does not currently encompass hosting setup, so hosting capabilities would be a plus. While I have not specified any particular WordPress plugin requirement yet, the chosen freelancer should be familiar with a range of plugins and ready to recommend if necessary. Key Skills Required: • Expertise in WordPress • Figma proficiency • Familiarity with various WordPress plugins • Possessing Hosting setup knowledge is a bonus.
We are in the initial stages of launching an exciting e-commerce project aimed at enhance the online shopping experience. Technical Aspects of the Project: - Development of a browser plugin that interacts with various e-commerce platforms. - Integration of AI technology to extract data and analyze shopping cart contents. (Text extraction) - Implementation of APIs to collect and compare product data in real-time. - Creation of algorithms to identify and recommend similar products. (Might not be needed) - Development of a scalable backend to support real-time data tools and user analytics. Requested Technical Skills: - Experience creating sustainable Data modells - Experience in browser-extension development with JavaScript, HTML, CSS, and modern frameworks (React, Angular, Vue...
...color scheme, and font selection ideas that can make our site more appealing and user-friendly. → Generate leads: The design and content should be engaging enough to capture leads, guiding visitors towards purchasing or getting in touch. → Offer a paid member-only page: I want to introduce a new feature to sell digital products online. This will require membership tiers/levels. → Minimum use of plugin → Support to light speed server → preferable theme- Astra → Paid membership- paid members can have access/view selected post/page → Restrict visitor to view page/post by login using mobile number and OTP → No screen shot/ screen recording of selected post/page → No Copy/paste of selected page/post → No printing as save as pdf → ...
I'm in need of a skilled app developer who can create a user-friendly, efficient hotel management app for Android. The app should include the following functionalities: - Room Booking: The app should allow guests to browse and book available rooms. - Payment Processing: The app should be capable of handling payment processing for the room boo...should have: - Prior experience in developing hotel management or booking apps, particularly for Android. - Strong skills in UI/UX design to ensure the app is user-friendly. - Proficiency in integrating secure payment gateways. next have gst text an ivoicing system and etc - Ability to deliver the project within the stipulated time frame of 20 days. If you meet these criteria and can provide a sample of your previous work, I'd lo...
Dear Freelancers, We're looking for someone who is proficient in WordPress and can efficiently handle tasks such as theme fixing issues, adjustments, plugin updates, and overall performance enhancements. Details: - Minor visual and functional tweaks - Updating and configuring plugins - Enhancing website performance and responsiveness Deadline: All updates must be completed by May 5, 2024.
I submitted a wordpress plugin to wordpress plugin directory and they asked for minor code quality edit. I want you to implement those edit. These are the things they mentioned to improve: * No GPL-compatible license declared * Data Must be Sanitized, Escaped, and Validated * Generic function/class/define/namespace/option names * Allowing Direct File Access to plugin files The plugin is functional without any problem and it's a simple plugin. I just need the code standard match with the wordpress plugin repository's guidelines.
I have recently completed the installation on AWS EC2 for my Mifos Fineract. I want to ensure these systems are correctly setup to make the most out of their capabilities. Specifically, I need: - Reporting Plugin Setup: The reporting plugin should enable real-time reporting, batch reporting and data visualization reporting, generated from the database. An understanding of how to utilize this plugin is essential for this job. - Account Setup: I am also wanting assistance with setting up basic accounting for savings, loan and FD/RD. Familiarity with accounting principles and experience using cloud-based financial management systems like Mifos Fineract is highly desirable. Ideal candidates will have experience with Pentaho, Mifos Fineract and AWS EC2, and be able t...
I am working on React JS with Javascript Development Project. I need someone to Support me for this Project atleast 4 to 5 hours Per day. Project wil...someone to Support me for this Project atleast 4 to 5 hours Per day. Project will Exist more than 2 years. I need support through Remotely(zoom). I am looking for Good Experienced(4+ years) Person as a Frontend Developer, Who can work on the tasks Quickly. I am looking for Long term relationship. After this Project Completed means, we will give immediately another support project. I will Give you the Sample Task for 1 Hour, If you Completed ON TIME means we will give you the Project. Required Skills : React JS, HTML, CSS, Javascript, Cypress Test Cases(Mandatory), SQL Basics Language Speaking Person : English Note: I will pay on ho...
I'm looking for a WordPress expert who can effectively deactivate and remove the LayerSlider plugin, and then re-install it from the plugin manager. Importantly, the sliders and settings should be preserved in the database and should be available post-re-installation as they were before. Key Requirements: - Deactivate and remove LayerSlider plugin - Re-install the plugin from the plugin manager - Ensure that sliders & settings are saved and restored post-re-installation You should have a solid understanding of: - WordPress - LayerSlider or similar plugins - Database handling (for preserving sliders & settings) The main focus is on preserving the sliders and settings. Important: Layerslider plugin came bundled with Theme. No Licen...
I'm looking for a talented developer with experience in HTML and inline CSS. I have two pages of text content in PDF and Word format which need to be artfully converted to HTML for email distribution. The critical specifications for this project are: - Efficient use of HTML tables to structure content - Inline CSS for styling to maintain presentation across various email platforms - No need for responsive design due to the email context
...Greenfield tower, Concordia Plaza, Tsim Sha Tsui, Kowloon, Hong Kong • Has a camera or phone/tablet of quality with a camera, internet access • Must be available during business hours (9 AM - 4 PM) on working days Please see the attached file for the site visit guideline. You are only required to deliver the pictures, video & observations and are not expected to put together a report like the Sample Report. Note: Milestone will be released the following week after the site visit to give us time to organize the report and contact you if we need additional clarification....
I'm seeking a proficient freelancer to convert my Google Document into a Word Document. My primary purpose for this conversion is to enhance the document's editability. The Google document content is a business report. You'll perform simple text editing tasks as part of this project. Please ensure you know how to maintain the integrity and original format of the report during the conversion and editing process. Ideal Skills: - Proficient in Google Suite & Microsoft Office Suite - Attention to detail - Experience in business report editing A freelancer with a strong background in business report creation and editing will be ideal for this task. Please share your relevant experiences in your proposal.
I'm looking for an experienced freelancer to convert a Google document into a Word document. The Google document may contain a variety of elements such as font styles and sizes, bulleted or numbered lists, and tables. Ideal Skills and Experience: - Proficiency in Google Docs and Microsoft Word - Experience in document formatting and conversion - Attention to detail in maintaining the original document's formatting I anticipate a quick turnaround for this project.
I need a professional to convert my Google document into a Word format. The primary purpose of this conversion is to share the document with my collaborators who use Word exclusively. The document contains integrated tables, graphs, and images. Not all of them have to be editable in the Word format. The freelancer must ensure that: - The converted Word document maintains the same formatting as the Google document. - Some tables, graphs, and images are editable as per my instructions, while the rest remain static. Ideal freelancers for this job would possess the following skills and experience: - Proficiency in Microsoft Word and Google Docs. - Abilities in discerning between editable and non-editable elements in a document. - Attention to detail to ...
I need an expert to integrate a court booking plugin it into my existing wordpress website, implementing several essential functionalities. Key Requirements: - Enable online booking on our website: - Email notifications: Skilled in setting up automated emails tied to successful booking, cancellations, or changes in booking status. - SMS Gateway - Payment Gateway I already have tried paid plugin but seems to be taking so much time so I need an expert to get this done quickly. Ideal freelancers should have a proven history of plugin integration, working knowledge of appointe booking software, and a deep understanding of automated system notifications. Familiarity with online booking systems and real-time calendar synchronization is highly desirable for this project.
...long term relationship with a skilled Word 2016 formatter. My documents primarily are text-based and I'd love to find a professional who can assist in formatting them in a polished, consistent manner using Word 2016 Professional Plus on my Windows machine. The following aspects need to be considered: - Header and Footer Customization: Ensure that these are set up correctly and consistently across all pages. - Automatic Table of Contents Generation: Establish a dynamic table of contents that updates as the document changes. - General Formatting in Word 2016: This includes a review of the overall layout, font selections, spacing, and any other formatting needs to make the documents look professional. The ideal candidate would have: - Proficiency in Word...
We are in search of new freelancers for a copy-paste task, involving short ms word documents. The job entails translating from English to various languages, including Spanish (Latin America), Spanish (Spain), French, Czech, German, Portuguese (Portugal), Hungarian, Ukrainian, Indonesian, Italian, Japanese, Arabic (Standard), and Korean.
I'm looking for an experienced WordPress developer proficient in theme customization, dealing with plugin conflicts, and fixing HTML/CSS bugs. This role requires expertise in deciphering and remedying possible conflicting plugins, though I have not yet identified which specific plugins are causing issues. Overall, your task is to ensure the seamless function of my WordPress site by: • Identifying problematic plugins • Resolving theme customization issues • Debugging HTML/CSS bugs Ideal candidates should have: • Extensive experience with WordPress development • Strong problem-solving skills • A keen eye for detail to identify potential conflicts and bugs.
I need a professional who is proficient in mail client settings, particularly Thunderbird, to configure my desktop environment such that incoming mails with specific subjects are automatically printed. This should be set up to use a black and white print setting. Skills and Experience: - Experience in work with Thunderbird mail client - Knowledge in automatic printin...password changes automatically. 1. Problem is either with our mail server. At WHM 2. Or pizzeria has a different webmaster or this webmaster has a PC automation that does that. That's why you should do the email installation. That it cannot be changed by anyone. And couldn't be deleted. That's why if you have a solution without Thunderbird. We can do it too. AND website is WORDPRESS (SMTP MAIL PLUGIN...
I'm looking to build a live dashboard that will display the results of both the Presidential and Local elections in real-time. Key Requirements: - I need the dashboard to be able to pull data from reliable sources(officials in polling sta...visualization. - Previous experience in creating dashboards for live events or elections would be a big plus. - Knowledge of data security protocols to ensure the dashboard is protected from any potential threats. - Strong UI/UX skills to design an appealing and user-friendly interface for the dashboard. - Experience in developing mobile responsive websites. -Should have map technology integrated (a sample is attached) This is an urgent project and I'm looking for a skilled and reliable professional to deliver a top-notch live electio...
We have a software written in c++ and we will like it to be linked to our tuning software winols is this something you can help me with Basically i have developed a software to turn off certain functions in a engi...say the user selects mercedes then selects edc17c66 ecu and want adblue dpf egr off the software will send the file they have uploaded to my winols and in my winols there will be a file for that sw version ecu and it will make all modifications taking the modifications from the modified file in my winols database and export the file back to the end user who is using the software And winols has a plugin called winols lua. Thats how you can make communication with winols externally Winols is using lua language to control winols externally, A video attached of the softwa...
...create a listing directory on my WordPress site. The directory should have a map and should be able to display business listings and provide a location-based search. Key Requirements: - The plugin should display business listings complete with business name, contact information, and photos and videos. - It should allow for a location-based search, enabling users to search for businesses within a specified area. - The directory should come with a map showing the locations of listed businesses. - The plugin should be seamlessly integrated into our existing WordPress site. Needs to be an installed plugin on wordpress - no cpanel direct installation. also need all my existing listings on another plug in to be trasnferred via an import into the new directory. All the...
I seek a professional, experienced designer proficient in both UI and UX design, to take on the design of a new website. Key Responsibilities: - Conceptualize and execute visually appealing and intuitive UI design - Focus on UX design that offers engagin...designed websites, ideally with a focus on young adult audience - A keen eye for aesthetics - Proficiency in design software - Strong problem-solving skills By understanding the needs of the demographic, you'll be tasked with delivering a polished, engaging, and user-friendly site that resonates well with our target audience. Let's shape digital experiences together. Please must attach work sample also we will need Figma files . NOTE: Please don't Bid if you can't reply instantly and have higher offer ...
I need someone with meticulous attention to detail to manually type the text from a PDF file into Word while applying a new format. Your task will involve: - Reading the text in the PDF file and typing it in a Word document. - Applying a totally new formatting scheme that I'll provide. - Ensuring that the text still makes sense after the reformatting. The ideal person for this job should have: - Strong typing skills. - Familiarity with Word formatting tools. - A keen eye for detail to ensure that everything is copied accurately. - The ability to reformat the text in an organized and pleasant way. The purpose of this task is to both edit the content of the file and extract specific information, so your ability to stay on task is essential.
I'm looking for a diligent freelancer to help me with a straightforward data entry task. The task involves: - Collecting text data from various websites - Organizing and inputting the data into Word documents. The ideal candidate should be: - Skilled at conducting online research - Proficient in Microsoft Word - Detail-oriented and able to maintain accuracy - Good at time management to ensure timely completion of the task. Your role will be pivotal in creating a structured, comprehensive database from the web content I provide.
Hello, We are looking for a Creative Designer to reproduce 3 kit of editable resume (CV) + cover letter templates. It’s to say 3 resume and 3 cover letter in Word and Mac Pages. We will give you 3 design to copy and just add small adaptation, because these creations/designs will be used for business purposes (resume website). • Each resume must be accompanied by a cover letter with the same style than the CV • Each resume and cover letter must be designed and delivered: o in 2 differents format (Word (.docx) and Mac Pages (Mac OS), o in A4 o in 4 colors Variations (we will give you the 4 colors variations). • For each resume create a variation of 1-page and another variation of 2-pages • Then we will need for each kit of “resume + cover lette...
Kami telah menyusun deskripsi proyek dari jawaban Anda. Tambahkan detail tambahan apa pun yang Anda ingin pekerja lepas ketahui sebelum melanjutkan ke langkah berikutnya Deskripsi Proyek Saya mencari seorang treelancer untuk membantu saya mengumpulkan data kuantitatif untuk penelitian akademis. Saya memiliki daftar sumber spesifik yang saya ingin datanya dikumpulkan Kemampuan dan pengalaman: - Pengeluaran dalam bentuk pengumpulan dan analisis data penelitian akademis
The Ultimate Guide to Tying Your Duvet Cover to the Duvet Insert - This is the Sample Blog Topic Reference:
Necesito un programa escrito en vb en el framework .net 4.6 y que utilice windows form para la siguiente tarea: > Credenciales del servidor FTP direccion: ftp:// user: android password: android > Descripcion de las rutas del servidor FTP donde el primer path / se ubicaran carpetas con años 2021,2022,2023 hasta la actualidad, ejemplo ftp://, ftp:// en el segundo path / seran carpetas con los meses del año representados con numero 1,2,3... ejemplo ftp://, ftp:// en el tercer path / existiran carpetas con los RFCs de los clientes con un formato similar a este IVD920810GU2, ejemplo ftp://, ftp:// dentro de este
I have a general idea of what I want to achieve. I have done similar thing in the past and can demonstrate to explain the goal. I’m looking for someone which obviously knows winCC and able to write VBS code to achieve goal
The fonts listed, when selected, the "Sample Text" should change to show the appropriate look of the selected 'font style' please fix and update with the font names shown in their font style (as now, only "Pacifico" font works properly) >>> Please use all font listed at <<< for font list
...content, we have to map it while requesting the required // mode of access (read, read/write). // This type of abstraction is necessary, because the buffer in question might not be // on the machine's main memory itself, but rather in the GPU's memory. // So mapping the buffer makes the underlying memory region accessible to us. // See: mapInfo := () defer () // We know what format the data in the memory region has, since we requested // it by setting the fakesink's caps. So what we do here is interpret the // memory region we mapped as an array of signed 16 bit integers. samples := () if len(samples) == 0 { return gst
I need a freelancer who can effectively convert a PDF file into a Word document. The purpose is to edit the document's content while retaining its original formatting. This should be an easy job, as the PDF contains simple text and no graphics, tables, or charts. In addition, it's crucial the Word document matches the exact formatting of the PDF. This job is ideal for freelancers with skills and experience in PDF conversion, document formatting, and text editing in Word. Accuracy and attention to detail are central to this project's success.
