Powerdesigner sample extended collection vb punët
...customers solving problems with deliveries, tracking parcels online (EestiPost, Omniva, DPD, TNT, FedEx, UPS, etc…) handling issues reported by clients with products delivered, managing issues in case of delays, making orders modification, invoice modification, address modification, managing communication about returns, disputes, refunds, etc… Quality assurance: performing quality inspection of the sample of the products manufactured in order to escalate with factories possible faults and quality fluctuations issues whilst following up with customers who have been affected by production issues. Online technical support and troubleshooting: supporting customers when payment error occur, issuing credit card refunds, spotting technical errors and mistakes on the ...
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
Sample ghkjkjgkjgkjhgjkgjkgkjgjggkgjkgjkggjggjkgjgjkgjkgjkgjkgjkgjkgjgjgjgjgjkgkgjkgjgkjkgjkjgjgjkgkjkj
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
...Customizable, responsive design tailored to our brand and product offerings, preferably using existing templates. Features: - Product catalog with categories and filters. - Stock availability & releases. - Secure user registration and login. - Shopping cart and checkout process. - Integration of payment gateways (e.g., Tabby, bank APIs). - SSL certification for secure transactions. - Shipping address collection. - Client database for storing customer information. Payment Integration: - Must integrate Tabby for installment payments. - Should integrate other payment methods (credit/debit cards, PayPal, etc.). - API integration for local bank payments. Additional Features: - Basic SEO optimization. - Mobile optimization. - Social media integration. - Contact forms and custome...
We will do only foundation with reinforcement as per sample we have will need $800 and 2 days.
...Golf Course Geographic Distribution of Customers Local Area Analysis: Breakdown of customers within a 10-mile radius. Analysis of nearby neighborhoods and communities. Heatmap visualization showing customer density. Regional Analysis: Breakdown of customers within a 50-mile radius. Analysis of major towns and cities contributing to the customer base. Heatmap visualization showing customer density. Sample Visualizations Heatmap of Customer Distribution: Shows areas with the highest concentration of customers. Bar Chart of Top 10 Cities/Towns: Displays the cities/towns with the most customers. Pie Chart of Customer Age Groups: Illustrates the distribution of customers by age group. Map of National Customer Reach: Highlights the states from which customers visit. I need a comprehen...
Overview: This application will enable Shopify store owners to collect and display customer reviews. However, only customers who have made a purchase will be able to leave a review. You can use the reviews app that Shopify provides as a :// Project Requirements: User Authentication: • There should be no public option for writing a review on the store’s frontend. Review Collection: • After a purchase, customers should receive an invitation via email to write a review. Review Display: • Reviews submitted by customers should be displayed on the respective product page of the Shopify store. Webservice Integration: • All reviews must be sent to an external webservice for additional processing or storage. Subscription Plans: • The
I'm looking for a talented graphic designer who can create top-notch infographics for product...graphic designer who can create top-notch infographics for product descriptions and feature explanations on Amazon. The infographics should capture the benefits of the product and provide instructions on how to use it effectively. Your responsibility will be: - To create clear, captivating infographics that give a neat portrayal of the product's advantages and usage. - Edit RAW photos as per sample provided that appeal notably to Amazon consumers. Ideal skills and experience: - Strong graphic design abilities - Photoshop Experience - Prior experience creating Amazon or eCommerce infographics - Understanding of consumer psychology, able to create designs that attract and reta...
I'm seeking a freelancer to develop a custom web scraping script. The goal is to curate a comprehensive database of restoration and IICRC technicians in Australia. Specifically, I need the following information from their websites: - Business name - Phone number - Email address - Location (state, suburb, postcode) Websites without data available to scapers will require manual collection The ideal candidate should be well-versed in web scraping, particularly with experience in extracting data from websites into an organised and structured format. You should also possess strong problem-solving skills to handle any complications that may arise during the scraping process. This is a specialised type of cleaning so the database should be broken down into service categories (exam...
I am seeking a skilled and experienced designer who can help me with a simple yet crucial task:...rebranding process, helping us to align our products with the new brand identity. Ideal Skills: - Extensive experience with Photoshop, particularly with the Hue/Saturation tool - A good eye for aesthetic improvements - Experience with product image editing or e-commerce Deliverables: - All files should be high-resolution(similar to original photos) and in a format same as given image not same as sample color image. Please let me know if you're proficient with Photoshop and have experience with similar projects. I'm looking forward to seeing examples of your past work. Attached Zip file of images. It includes 12 colour variations and 2 products. It means, total 24 variatio...
I have a collection of handwritten notes in Malayalam that I need transcribed. The transcribed data will then be used for data analysis purposes. Ideal Skills and Experience: - Proficiency in Malayalam language - Excellent transcription skills, particularly in dealing with handwritten text - Experience in qualitative data analysis processes Please note that the data contained in these notes is crucial for my project's success, so accuracy and attention to detail are paramount. If you feel you have the necessary skills to undertake this task, please get in touch.
I am seeking an experienced programmer to recode a C++ webview2 sample program to use win32 calls compatible with a Microfocus Visual COBOL environment. This transformation involves a focus on maintaining critical user interface functions presently coded within the C++ webview2 sample. Key aspects of the project: - Conversion to Microfocus Visual COBOL - Prioritization and preservation of User Interface functionality Ideal skills and experience: - Proficiency in C++ and Microfocus Visual COBOL - Experience with understanding, adapting, and recoding complex coding samples - Familiarity with using win32 calls - A strong background in UI integration and function transfers.
We need an Illustrator to overwork and redo an existing design of a package for a pizzacarton. The artwork of the original is " sunken in the nirwana" so we have to redo it. Result we need an unscreened template. The sample is NOT the template we need - but very similar. The template will be supplied after we arranged the job in full. we need an appropriate template
...names, emails, and phone numbers of leads in real-time as soon as they visit a specific page. The collected data should be simultaneously sent to GoHighLevel (GHL) CRM for automated text and phone call follow-ups, as well as to an Excel sheet for manual review and further action. Key requirements: - Pixel Integration: Develop and implement a pixel solution that captures lead data. - Real-Time Collection: Ensure the system collects data instantly when a lead lands on the specified page. - GoHighLevel (GHL) Integration: Connect the system to GHL for automated text and phone call follow-ups. - Excel Integration: Enable the system to send collected lead data to an Excel sheet via email. Ideal skills and experience: - Proficiency in WordPress and pixel integration. - Experience with...
Position: YouTube SEO Keyword Editor (Full-time) Location: Work From Home, Vativa Design & Development We're seeking a dynamic individual to fill the role of YouTube Content Sr. Executive at Vativa Design & Development in Chennai. This position is ideal for someone passionate about crafting engaging content, manag...to reach 10k viewers per week Requirements: - Bachelor's degree in any discipline. - Demonstrated proficiency in video editing software like Vizard, Adobe Premiere Pro or Final Cut Pro. - Thorough understanding of YouTube and social media platforms, including current trends and best practices. - Familiarity with social media SEO and adeptness in keyword optimization techniques. Please send the sample while applying for this post. *** Only looking fo...
I'm seeking a talented developer to fix an issue with gtag on my WordPress website. The specific problem is that gtag is not tracking website events as expected. Key Responsibilities: - Troubleshoot and rectify the gtag implementation for event tracking on a WordPress website. - Ensure that all events are being properly tracked and sent to Google Analytics for accurate data collection. Ideal Candidate: - Proficient in WordPress development with a deep understanding of gtag implementation. - Experienced in resolving tracking issues and ensuring data integrity in Google Analytics. - Familiar with debugging tools to identify and fix the gtag tracking issue effectively. I have previously attempted to address the problem by using a plugin for gtag integration. However, the issue ...
I'm in search of a ski...Experience in creating personalised news media content and working with API content feeds is a must. - **WordPress Development Expertise:** Proficiency in WordPress development is essential. - **E-Commerce Skills:** Understanding of e-commerce functionalities and payment gateway integration. - **Marketing and Analytics Experience:** Knowledge of inbound and outbound marketing strategies, data collection (email addresses, cell phone numbers) and data measurement is required. You will need to be able to set and achieve traffic and revenue targets and earning comission and success fees as part of an on going contract renumeration. Need someone that wants to make a fair base hourly rate andcearn large success fees from traffic flow gains and sales in the...
I need a freelancer to help me gather phone numbers from clothing stores in County . You'll be provided with the location and shops to focus on. Key Responsibilities: - Utilize street view to identify shops - Collecting phone numbers of all such shops - Organize and input these numbers into an Excel spreadsheet Ideal Skills: - Proficient in using street view and other location tools - Detail-oriented and capable of data entry - Comfortable using WhatsApp for communication This is a straightforward project, but attention to detail is crucial. Feel free to reach out if you have any questions.
...representation of the key aspects of my business. - Colors: Predominantly use blue and white. Feel free to incorporate additional colors only if they blend well and look professional. The blue from the website is hex #087E8B The while from the website is #F7F7F9 - Style: The logo should have a modern look, steering away from traditional designs. The text on our website for headings is 'Nimbus Sans Extended' & the text is 'NEUE HAAS UNICA - Optional Symbolism: You could incorporate an upwards arrow or graph as a key element in the design to depict growth and progress. This element should be subtle yet explicit in its representation. We are open to seeing other symbols or none. Our website is: Please use this to get a feel of the existing branding, colour...
I am working on React JS with Javascript Development Project. I need someone to Supp...someone to Support me for this Project atleast 4 to 5 hours Per day. Project will Exist more than 2 years. I need support through Remotely(zoom). I am looking for Good Experienced(4+ years) Person as a Frontend Developer, Who can work on the tasks Quickly. I am looking for Long term relationship. After this Project Completed means, we will give immediately another support project. I will Give you the Sample Task on Cypress Test Cases for 30 mins, If you Completed ON TIME means we will give you the Project. Cypress Test Cases Immediately Required. Required Skills : React JS, HTML, CSS, Javascript, Cypress Test Cases(Mandatory), SQL Basics Language Speaking Person : English Note: I will pay on ho...
I'm seeking a knowledgeable Arduino and IoT expert to create a sophisticated system for collecting data on water flow. Key functionalities required: - Pulse input data collection, specifically for monitoring water flow. - Understanding of Deep Sleep Mode to save Battery. - Data handling capabilities to efficiently send this information straight to the cloud system. The ideal freelancer for this project must demonstrate vast experience with Arduino programming, IoT systems, and data management. Familiarity with cloud technologies will be a significant plus. Ability to create a robust system capable of handling potential fluctuations in water flow is necessary. The chosen developer will be tasked with not just simple data gathering, but also with transferring these datasets t...
I need to find a skilled web developer for building a promotional website specifically targeting potential customers. The website would be largely multimedia-centric with a focus on images and videos showcasing the various aspects of my business. Requirements: - Proven experience in creating dynamic, multimedia-heavy websites - Understanding of how to optim...best practice to target potential customers effectively. Remember, the primary goal of this website is business promotion, specifically with potential customers in focus. Thus, the aesthetics, design, and content of the website should all align perfectly with this objective. The quality of images and videos would be of paramount importance, so prior experience in handling such content is a must. Sample websites are Dantec an...
Expertise: Ability to create a website with a modern, clean design similar to Ntiva. The site must feature unique pictures and content specific to Tymor Technologies. 3D Logo and Animations: Proficiency in integrating 3D logos and dynamic animations. Communication Skills: Excellent communication skills with the ability to provide regular updates via WhatsApp. Timeline Commitment: Ability to deliver a sample home page within 1 day of the start date and complete the entire website within 2 weeks. Content Development: Capability to create and integrate 25+ content-rich pages. Hosting Knowledge: Familiarity with WordPress, which is already active for hosting on our domain. Professional Input: Ability to provide examples and ideas to enhance the website’s design and functiona...
...gym owners, with a focus on capturing between 100 to 500 individual records. The data needed includes, but not limited to: - Owner's Email Address - Gym's Name - Gym's Website Ideal candidates for this job are experienced data miners and researchers. Having a good understanding of the Fitness industry would be beneficial. Strong attention to detail is paramount, ensuring accuracy in data collection and entry. Additionally, demonstrating respect for privacy laws and guidelines, including GDPR, is essential. Experience with spreadsheets and CRM systems would be advantageous. Gyms must be privately owned only, non franchise. Offer Personal Training. Boutique Exclude: Category - Fitness Equipment Category - Community Health Centres & Services Category - Commu...
I'm currently in the process of setting up a new enterprise and I'm looking for a talented graphics designer to assist me in the creation of a logo and some additional graphics. Key Points: - The primary task will be the design of a logo and websi...interested in additional supporting graphics to complement the logo and establish a consistent brand identity. - The successful freelancer should have a strong portfolio of past work in logo and graphic design. Please include relevant samples in your application. - I have an idea of what I have in mind please see attached I am thinking it needs to have a boy and girl panda, I don' like the eyes in the sample files. The business is called Panda Game Zone I am excited to see your past work and hear your ideas. Looking for...
I need an individual from Mexico City who can conduct a comprehensive market research focusing on the black beans industry. The research will cover a...current distribution networks, challenges, and opportunities. - wholesale market of agricultural products - Agricultural supermarket - Ideal Candidate: - Located in Mexico City for on-ground research. - Strong background in market research and analysis is a plus. - Understanding of the food industry, specifically beans, is a plus. - Proficient in Spanish and English for accurate data collection and reporting. - Excellent communication skills to interact with different stakeholders. This is a part-time position with a flexible schedule, suitable for an individual who can dedicate time to this project alongside other co...
I'm looking for an experienced Hindi female voice over artist with a professional tone for my Youtube channel. - The voice over should be: - Clear, professional, and engaging - Appropriate for an adult audience - The project involves: - Narrating educational content - Adhering to the script provided Ideal skills and experience for this project include: - P...an adult audience - The project involves: - Narrating educational content - Adhering to the script provided Ideal skills and experience for this project include: - Proven experience in voice over work, ideally for educational content - Fluency in Hindi and understanding of professional tone and delivery - Ability to engage an adult audience through voice Please provide your portfolio or sample work for my...
...showcasing our service quality, and attracting potential customers and build an engaging follower base. Key Responsibilities: - Develop a content (including themes for stories) calendar, considering a mix of vehicle showcases, before and after photos, and customer testimonials. The calendar should be designed for posts 2-3 times a week in a mix of reels and posts. The grid calendar should show a sample photos of what the post/reel cover should look like and a theme fot the post. The stories should be general ideas for daily stories (5 days per week) - Implement a balance between thematic content planning and random content. I am open to a mix of both approaches if you believe this will help improve our engagement. Skills and Experience: - Prior experience managing Instagram acc...
...able to: - Translate the spirit of my program into a visually appealing design - Understand the color scheme of red and yellow - Incorporate the elements of a bold S logo, circled by hands into the design. - view examples and use them for specific inspiration It's a youth program for kids ages 6-18 that combined education, outdoors, and leadership. I have provided the font sample and logo sample along with colors and help me design a logo. I have given 2 specific S examples only use those or small variances of those logos Must have hands around it to be considered Must use tagline "seek and you shall find under or around logo Only use the two S logos for design inspiration and do not variate to far. My main goal is to combine the elements w...
...experienced video editor who can create professional and clean YouTube thumbnails and custom content videos that extend beyond 10 minutes. - The ideal candidate must have a knack for minimalistic yet appealing visuals. I'm particularly interested in those with a keen eye for detail that can convey the essence of my videos effectively via the thumbnails. - As my videos are custom and relatively extended content, I'm looking for someone who can creatively break down the gist while maintaining the allure, ensuring the viewers stay engaged and find the content insightful. Skills and Experience: - Proficient in video editing software such as Adobe Premiere Pro, Final Cut Pro etc. - Experience in creating engaging YouTube Thumbnails - Ability to work within stipulated t...
I'm seeking a freelancer to collate verifie...verified contact details of travel agencies from the UK, USA, Europe, and Latin America. Key project details: - Data to be collected: Only contact information (phone, email, address,webiste link )of decision makers is needed from each agency. - Data segmentation: The collected data should be segmented by country. The purpose of this data collection project is to generate leads for my business. Ideal Candidate: - Experience in web research and data collection. - Familiarity with the travel industry would be a plus. - Attention to detail to ensure accurate data gathering. - Ability to organize data by country for efficient lead generation. Please bid if you are confident in your ability to deliver accurate, segmented da...
I'm seeking a talented male voice-over artist to create a Chinese advertisement for my product. The voice-over should be warm and engaging, aiming to draw in the listener. Key Requirements: - Voice Tone: The ideal candidate should have a voice that is naturally friendly and inviting. Please avoid overly formal or energetic tones. - Gender: I am specifically looking for a male voice-over a...should have a voice that is naturally friendly and inviting. Please avoid overly formal or energetic tones. - Gender: I am specifically looking for a male voice-over artist for this particular project. - Experience: Prior experience in creating Chinese advertisements is highly preferred. Please provide a demo or samples of previous work in your proposal. - Duration: 1 Min Video. - Share your voic...
A new project and would like to know if you are interested in taking it on. The main task is data collection, with the detailed requirements
hello, there, We need some Native Austrian and German to do a recording task, they are short sentences, the recording would take you about 15 minutes, the budget is $9 for the whole task the speakers need to be: -Age...voiceover or amateur -Equipment: You just need to have a good phone. The recording script is in our recording app so you will need to download our recording app and then use task name we provide to log in and record. -Envrionment: Please record in a quiet room, no echo, no other noise like birds noise, car noise and so on. Don't need to use earphone or bluetooth. -Pronunciaiton: we will provide a few sample audios for you to check the pronunciation we need, you need to listen them first before starting the recording task If you are interested in it, please con...
...locked position in front of the cabinet should be ensured with a fully-automatic locking mechanism. Product is hidden under cabinets until extended for use. Most important features are ease of use and most important is SAFETY. It needs to be CAD ready to be put into production Ideal candidates would: * Be skilled in working with metal * Demonstrate experience in creating functional, compact, retractable mechanisms * Have an understanding of traditional aesthetics and how to incorporate it into modern, utilitarian designs * Possess familiarity with fully-automatic locking systems. Take note, the stairs must brace securely against the cabinet when extended and locked in place. Final product must ensure safety and ease of use. I am excited to see your creative solution...
I'm in need of a talented individual from Ghana who can assist me with interview transcription and Akan language translation for market research purposes. Required Skills/Experience: - Proficiency in Akan language and English - Experience with market research data collection and transcription - Excellent attention to detail - Ability to maintain confidentiality The candidate should be able to translate interview transcripts from English to Akan, while ensuring the accuracy and quality of the data collected. The collected data will be used for qualitative analysis, so the individual should have a good understanding of the market research process. This project will be ongoing, with the possibility of more work in the future. Experience in market research, transcription, and ...
I am in need of a professional who can design a lead generation page aimed at small business owners. ...design a lead generation page aimed at small business owners. The page is meant to collect both email addresses and phone numbers. Key requirements: - Design, build, and optimize a lead generation page specifically for small business owners - Ensure the page is user-friendly and effectively captures both email addresses and phone numbers - Implement best practices for lead generation and data collection Ideal Skills and Experience: - Proven track record in designing and creating effective lead generation pages - Understanding of user experience and conversion optimization - Familiarity with lead capture software and tools - Previous experience working with small business owners...
I'm looking for a skilled React Native developer for api integration , skins and postman collection is ready. Total 13 apis Key Requirements: - Proficiency in React Native for both iOS and Android platforms - Prior experience in developing e-commerce applications - Ability to implement custom features as per the requirements of the project - Strong understanding of user profiles & authentication, product catalog & search, and shopping cart & checkout process Your primary focus will be on creating a seamless e-commerce experience for customers through the implementation of custom features. Your expertise in React Native will ensure the application is user-friendly, reflects the brand's identity, and meets the specific project requirements. Ideal Skills and ...
I'm looking for a skilled tattoo designer who can create a unique black and white tattoo design to be placed on my arm. Ideal Skills and Experience: - Proficient in tattoo design - Expertise in black and white art - Understanding of arm tattoo placement Additional Notes: - I'm open to creative su...design to be placed on my arm. Ideal Skills and Experience: - Proficient in tattoo design - Expertise in black and white art - Understanding of arm tattoo placement Additional Notes: - I'm open to creative suggestions and ideas - The design should be original and not copied from existing tattoos Existing tattoo sample picture added. Would like a unique tattoo designed based on the lower flower and leaves. Back half of upper arm. Could be a mixture of flower types that ...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
Hello, We are seeking a Data Researcher who can leverage cutting edge data collection technologies to gather accurate and verified business contact data. Though this is a onetime project, this project will serve as a test trial to see if your services are the best fit for our use case. Scope of Work: The Data Researcher will utilize their own tools to collect and verify 2,500 unique business contacts according to the specifications provided, and all contact detail data must be verified using third-party tools before submission. Only verified records will be accepted, and payment will only be issued for data that is verified to be accurate. Verification Process: After you have submitted the verified data, we will also be verifying the data ourselves to ensure the accuracy of the ...
ATTENTION: This is not a project to create a 3D model. It's to create a sample mobile app in Flutter. I need a 3D object renderer programmed in Flutter for PLY files. The intended purpose is visualization rather than animation or virtual reality. The selected candidate should possess: - A strong knowledge of Flutter and 3D rendering techniques. - Previous experience in creating high-quality renderers, as this project demands a high-performance level. The renderer should include the following functionalities: - The ability to rotate objects. - Zoom in and out capabilities. As an expert in this field, you're expected to provide advice on the best techniques and practices to achieve a high-quality 3D object visualization. The Flutter project need to be executable on b...
I’m seeking a skilled developer to convert my existing PortVB Desktop App into an iOS/Mac Desktop App. It a small tool that runs on a Windows PC and reads some flat XML files and inserts/updates a mySQL database. We need the same program to be able run on a iOS/Mac desktop. I have all the VB Project files/ Source code. - Skills in app development for iOS/Mac, ideally with previous experience in app conversion - Knowledge of data syncing, user authentication, and offline access, in case these features need to be incorporated - Familiarity with contacts management, communication, scheduling, calendar integration, and file/document management functionalities for potential focus areas - Creative design skills to potentially revamp the user interface and overall design of t...
...to progress objects based on attribute changes. - Crucial to this project is the seamless integration of these hosted layers with workflows to monitor progress status. Furthermore, these layers need to be strategically integrated with field data collection workflows, contributing to an overall streamlined data collection and management process that can ultimately be view from office-based and mobile end users. Ideal skills and experience: - Extensive experience in Arc GIS and database integration. - Prior experience with Data Collection and workflow integration. - Excellent understanding of raster layer creation using various data sources. - Hosting and publishing as hosted service layers. - Integration of maps with mobile applications. - Integration of...
...floor plans. Scope of work: Update plans and make necessary modifications per information below. We want to make some changes to the attached plans. The main objective was not to compromise the roof lines and exterior. Scope of work- Masterbath- Bumpout for Tub with side roof. Will not affect main roof. Masterbath and Closet reworked and extended this area along with the garage back 5’-0” existing roof pitch will extend. Bedroom 3- Extended this area back 5’-0” and added a pitch roof to the existing roof line. Moved rear porch demising wall over 3 ft to expand the width of this room. Need to resize living room windows next to back door. Prefer Qty.3 3060 windows with 3080 door in living room. No need to update the window and door schedul...
I'm seeking a talented actor with expertise in drama acting. Your role will be to act as a police officer at my house. It will be a brief, engaging performance lasting no more than 15 minutes. The scene is set at an indoor...officer at my house. It will be a brief, engaging performance lasting no more than 15 minutes. The scene is set at an indoor residence. Here are a few key requirements: • Proven experience in drama acting • Able to convincingly portray a police officer • Comfortable performing in an indoor residential environment • Ability to deliver a compelling performance in less than 15 minutes Please provide a sample of a drama acting role you have performed in the past, particularly if it's similar to this project. Looking forward to collabo...
I'm looking to collaborate with a skilled freelancer to develop a comprehensive online module on research methodology. This module is aimed at non-clinical staff and graduate students who are beginners in the field of research methodology. Key Objectives: - Develop a module consisting of 5 to 10 engaging lectures - Covering key topics such as Introduction to Research Methodology, Data Collection Methods, Data Analysis Techniques, Basic Statistics, and Writing Manuscripts for Publication - Ensure the content is beginner-friendly Ideal Skills and Experience: - Experience in developing educational content or courses in the field of research methodology - Strong understanding of research methodology and the ability to simplify complex concepts for beginners - Good knowledge of ba...
I'm looking for a professional who can assist me in automating the employment verification process, specifically for background checks. The system should require minimal h...online forms. - The process should be fully automated, requiring as little manual intervention as possible. - The system should be secure and reliable, ensuring the privacy and accuracy of the information collected. - The verification process should be optimized for background checks. Ideal skills for this job include: - Experience in software development or automation, particularly in data collection and processing. - A background in data security and privacy, as this is crucial for the handling of sensitive employment verification information. - Familiarity with background check processes is a plus, but...
...the beauty and unique experiences of various locations in Thailand. - Customer Reviews: A section that showcases customer reviews to build trust and credibility. Booking Options: - Flight, Hotel, and Tour Booking: The website should provide users with a seamless booking experience by offering booking options for flights, hotels, and tours. Website Content: - High-Quality Destination Photos: A collection of high-quality images that capture the essence and beauty of Thailand's various destinations. - Travel Blog: An engaging and informative travel blog that provides readers with insider tips, recommendations, and engaging content about traveling in Thailand. - Package Deals: Displaying enticing package deals to attract potential customers and encourage bookings. Ideal Skill...