Filtër

Kërkimet e mia të fundit
Filtro sipas:
Buxheti
deri në
deri në
deri në
Lloji
Aftёsitё
Gjuhët
    Shteti i punës
    2,000 vb c punët e gjetura, me çmimin EUR
    Project for Donjet S. Ka përfunduar left

    Pershendetje! Une punoj per ni Kompany gjermane dhe na duhet ni C# Developer me kontrat Pune fix. Remote ose on Site Te klienti. A keni interes per ni kontrat Pune? Nese Po ti kisha dergu pershrikimin e punes. Pershendetje nga Gjermanija Bajdin Avdylaj

    €239 (Avg Bid)
    €239 Oferta mesatare
    1 ofertat
    Project for Shasivar R. Ka përfunduar left

    Pershendetje! Une punoj per ni Kompany gjermane dhe na duhet ni C# Developer me kontrat Pune fix. Remote ose on Site Te klienti. A keni interes per ni kontrat Pune? Nese Po ti kisha dergu pershrikimin e punes. Pershendetje nga Gjermanija Bajdin Avdylaj

    €239 (Avg Bid)
    €239 Oferta mesatare
    1 ofertat
    Project for Tanushree C. Ka përfunduar left

    u done plz help me iam begineer

    €6 (Avg Bid)
    €6 Oferta mesatare
    1 ofertat
    Project for Shubham C. Ka përfunduar left

    hi call me shubaham ok

    €1 / hr (Avg Bid)
    €1 / hr Oferta mesatare
    1 ofertat
    €17 / hr Oferta mesatare
    1 ofertat
    €173 Oferta mesatare
    1 ofertat
    Project for Advytha C. Ka përfunduar left

    ushshhzudhshs

    €6 (Avg Bid)
    €6 Oferta mesatare
    1 ofertat
    Project for Arun C. Ka përfunduar left

    Përshëndetje Arun C., Unë vura re profilin tuaj dhe do të doja t'ju ofroja projektin tim. Ne mund të diskutojmë detajet nëpërmjet çatit.

    €232 (Avg Bid)
    €232 Oferta mesatare
    1 ofertat
    Project for Glory C. Ka përfunduar left

    contect me 7405575000

    €1 - €1 / hr
    €1 - €1 / hr
    0 ofertat
    €56 Oferta mesatare
    1 ofertat
    €69 Oferta mesatare
    1 ofertat
    €597 Oferta mesatare
    1 ofertat
    Project for Klotilda L. Ka përfunduar left

    c kemi , si je ? a ke arrittur te perfundosh ndonje projekt , ja vlen me te vertete te jesh pjese e kesaj faqe , a funksionojne me te vertete keto punet online ? te me falesh per shqetesimin , diten e mire !

    €232 (Avg Bid)
    €232 Oferta mesatare
    1 ofertat
    Proyecto para Jessica C. Ka përfunduar left

    dime si te interesa

    €2 / hr (Avg Bid)
    €2 / hr Oferta mesatare
    1 ofertat
    Project for Qubitzz C. Ka përfunduar left

    Pershendetje qubitzz .....

    €232 (Avg Bid)
    €232 Oferta mesatare
    1 ofertat
    Project for Qubitzz C. Ka përfunduar left

    Përshëndetje Qubitzz C., vura re profilin tuaj dhe do doja t'ju ofroja projektin tim. Mund të diskutojmë hollёsitё në çat.

    €742 / hr (Avg Bid)
    €742 / hr Oferta mesatare
    1 ofertat
    Project for Alchemy C. -- 2 Ka përfunduar left

    install check-me

    €37 (Avg Bid)
    €37 Oferta mesatare
    1 ofertat
    Project for Peter C. Ka përfunduar left

    Përshëndetje Peter C., vura re profilin tuaj dhe do doja t'ju ofroja projektin tim. Mund të diskutojmë hollёsitё në çat.

    €232 (Avg Bid)
    €232 Oferta mesatare
    1 ofertat

    Help me

    €86 (Avg Bid)
    €86 Oferta mesatare
    9 ofertat
    qefqreqweqawdafsc Ka përfunduar left

    asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

    €184 (Avg Bid)
    €184 Oferta mesatare
    1 ofertat
    C++ Programming task given Ka përfunduar left

    sjdbsliafhi'oqwja'nc;abjsfpwquhfajdaop'ndowbf9[whd9qjdop'adnABJFP9fhjwqo]jFSO;ABFI[GFHW9QiAJDPN;ASbfdpUHF

    €9 / hr (Avg Bid)
    €9 / hr Oferta mesatare
    1 ofertat
    java .............. Ka përfunduar left

    java Assignment... ................c fvvfvf fcqfrcvlrkcv'fmvk'qviqernvoiqrjfoqrjv;oiqjv;oirejiornv;ejrvioerjv[oiarjvnlreuhnior[vjer;ivnfe;vinelvkjfnrv;aoi'evn[aeirfj[oqreihvnperu;gbhqr[eiovj[quv

    €14 (Avg Bid)
    €14 Oferta mesatare
    1 ofertat
    yveguwvcjnjnecbkhb Ka përfunduar left

    ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

    €105 (Avg Bid)
    €105 Oferta mesatare
    1 ofertat
    c application Ka përfunduar left

    make a c applicatoionniwahdjksajk jksadbkjasbdkj bksajbdkjsabkjdb jaksbfkjasbkfjb kasjbfk bsakj bksjafbaksjbc

    €1 / hr (Avg Bid)
    €1 / hr Oferta mesatare
    1 ofertat

    We're seeking freelance programmers with a flexible skill set as the specific programming languages and project objectives weren't defined. An ability to adapt to various programming languages would be ideal, encapsulating yet not limited to Java, Python, and C++. As the project's main target and functionality weren't specified, experienced bidders with diverse backgrounds in creating mobile apps, website development, and software application building would be preferred. This project may contain elements like user authentication, database integration, and payment processing. It's important you're adaptable and comfortable with possible modifications as the project progresses.

    €18 (Avg Bid)
    €18 Oferta mesatare
    8 ofertat

    Hi Natalia C., I just need you to change the name and the pics

    €23 (Avg Bid)
    €23 Oferta mesatare
    1 ofertat

    Hi Md Morsalin C., I noticed your profile and would like to offer you my project. We can discuss any details over chat.

    €23 (Avg Bid)
    €23 Oferta mesatare
    1 ofertat

    Hi are you available for a session sometime within the next 8 hours? I am looking for someone to help teach me and help me to create a C# Web API using ASP.NET core which will be a middleware between an Angular front end and a deep learning model backend I have completed a basic start up from Microsofts tutorial - but I am struggling to understand how to link the C# Web API to the front end and to the back end The front end at this stage is a simple button that will endeavour to upload an image for classification - the backend at this stage is a sequence of image pre-processing steps to segment the area of interest from non-areas of interest

    €626 / hr (Avg Bid)
    €626 / hr Oferta mesatare
    39 ofertat

    Hi Tanushree C., I noticed your profile and would like to offer you my project. We can discuss any details over chat.

    €122 (Avg Bid)
    €122 Oferta mesatare
    1 ofertat

    I require a talented software developer to create a des...software developer to create a desktop application with proficiency in C++ and Lua scripts. The main function needed for this software is Electronic Control Unit (ECU) tuning. Ideal skills and experience: - Proficient in C++ and Lua Scripts - Experience in software development, particularly for desktop applications - Knowledge or experience in ECU tuning technology would be highly beneficial I have written a software in c++ i will like someone to be able to link my software to my winols witch is on another pc and for example someone loads a file in my c++ software it will then automatically send it to my winols find a file witch is modified acording to how the user wants the file to be modified then ret...

    €618 (Avg Bid)
    €618 Oferta mesatare
    25 ofertat

    I'm in need of an expert in c who can design and integrate GTK-based project. The project aims to enhance the GUI design and user experience. Key Requirements: - Experience in GTK: Prior experience in GTK-based software development is crucial for this project. - Cross-Platform Application: The final product should support Windows, Linux, and MacOS. Ideal Skills and Experience: - Proficient in GUI Design: The ideal candidate should have a strong background in GUI design and development. - Familiar with Motif Libraries: Prior experience in creating and integrating motif libraries is highly preferred. - Knowledge of GTK: Experience in GTK-based projects is a significant advantage. - Cross-Platform Development: Understanding of cross-platform application development and compati...

    €506 (Avg Bid)
    €506 Oferta mesatare
    34 ofertat
    Trophy icon I need cpp code 3 ditë left

    ...low-level Windows C++ development. Key responsibilities include: - Investigating the root cause behind the spooler crashes - Guide towards the successful completion of the project Desired experience and skills: - Extensive experience with Windows C++ programming, particularly at a low level. - Understanding the complex nuances of printer operations, including how spooler functions. - Ability to clearly communicate troubleshooting strategies and solutions This project offers a unique opportunity for a skilled Windows C++ developer to showcase and develop their problem solving ability. Knowledge of printer port monitoring is a requirement for this job as well. The main focus is on low-level C++ development on a Windows platform. PLEASE NOTE: If...

    €96 (Avg Bid)
    I garantuar
    €96
    2 kandidaturat

    I have 2 issues that are occurring with my app. Both of these issues are now happening on my app in the store when no changes were made. In other words, these crashes are not from any changes I made. It just started to not work. The first issues occurs when trying to login. It is timing out. This is the second error I'm getting is a crash that occurs after signing in: ** Assertion failure in UITraitCollection *UIViewControllerMissingInitialTraitCollection(UIViewController *__strong, UIApplicationSystemVersion)(), UIViewController.m:2749 *** Terminating app due to uncaught exception 'NSInternalInconsistencyException', reason: 'UIViewController is missing its initial trait collection populated during initialization. This is a serious bug, likely caused by accessing...

    €142 (Avg Bid)
    €142 Oferta mesatare
    30 ofertat
    ML.Net c# predictive model IA. 6 ditë left
    VERIFIKUAR

    Seeking a developer with experience in C# and SQL for a predictive artificial intelligence project. Your role will involve developing a model to predict user behavior on a vending machine, utilizing data stored in SQL Server. Proficiency in artificial intelligence is required. Please don't send a bid to later try to increase it. Will be declined.

    €543 (Avg Bid)
    €543 Oferta mesatare
    46 ofertat

    I just need a c# Console application that will take an Adobe Illustrator (.ai) file and save it as a PDF file and also save it as a PNG. I should be able to specify the width of the PNG and have it set the height automatically based on the source file. The PNG also needs to have transparency instead of a background for the "art board". This needs to be done without requiring expensive 3rd party components.

    €24 (Avg Bid)
    €24 Oferta mesatare
    22 ofertat

    My projec...latest cybersecurity regulations and best practices. You can pick any topic here and work on: 1) a. b. c. d. Paper that can win such grants: 1) 2)

    €312 (Avg Bid)
    €312 Oferta mesatare
    12 ofertat
    C# IDA Pro Reverse Engineering 6 ditë left
    VERIFIKUAR

    I'm looking for an experienced professional to assist me in reverse engineering with IDA Pro. This is a personal project, and my main goal is to create an offset values emulator. Key Responsibilities: - Utilize IDA Pro to reverse engineer specific C# applications - Develop an offset values emulator - Assist in understanding the functionality of the application Ideal Skills: - Proficient in C# and reverse engineering techniques - Experience with IDA Pro - Strong understanding of software vulnerabilities - Ability to create an offset values emulator - Excellent communication and team collaboration skills The project deadline is within 10 days. I look forward to working with a skilled and experienced professional who can assist me in achieving my project goals.

    €194 (Avg Bid)
    €194 Oferta mesatare
    11 ofertat

    Se busca desarrollador que domine lenguajes de programación c/c++ para placas de desarrollo ESP32 que tenga conocimientos en peticiones http para conexión con base de datos de Google Realtime Database. Así mismo , quien aspire al puesto tendrá que saber sobre redes wifi hotspot y preferentemente saber hacer lecturas a los componentes de la placa ESP32. Conexión a traves de MQTT. La PCB la tenemos fabricada, facilitaríamos esquemáticos, BOM de componentes, etc, para facilitar el entendimiento de la misma. Imprescindible que pueda mantener una conversación hablada en Español. EXPLICACION MAS EXTENDIDA Probulon es un proyecto de IoT basado el EPS32 donde maneja diferentes sensores y automatiza diferentes ór...

    €375 (Avg Bid)
    €375 Oferta mesatare
    4 ofertat

    Hola, Buscamos a un especialista en diseño de circuitos electrónicos para diseñar varios prototipos iniciando con el desarrollo de un dispositivo de toma de huella dactilar para llevar el registro y control de asistencia con base de datos enlazada a una web. Se valorará experiencia de programación (PhP, Python, C++), y el haber trabajo con placas como Arduino, RaspBerry y SP32 Tenemos varios proyectos, en los que hay que ir trabajando (Diseño de una consola portatil para correr un video juego propio creado en RPG MAKER XP) Un saludo

    €12 / hr (Avg Bid)
    €12 / hr Oferta mesatare
    12 ofertat

    I'm searching for a proficient C# developer who is experienced in handling CSV files. Tasks to Perform: - Reading and parsing CSV files - Writing and updating data to CSV files This role will require dealing with CSV files of medium size (10KB - 1MB). Data Processing Requirements: - Sorting or filtering records within the CSV files - Formatting data before saving back to the CSV Ideal candidates should possess strong skills in data manipulation and a solid understanding of C# programming to adequately meet requirements and perform tasks efficiently.

    €21 (Avg Bid)
    €21 Oferta mesatare
    5 ofertat

    I am in need of a proficient C++ programmer who can create a software for Windows operating system that will effectively detect specific events when a USB device is plugged in. Registry Scrubber Key Features: - The software should monitor and identify the type of device that is connected to the USB port. - It should have capability to store this device data and send using RS-232 to an external MCU - It should also detect and monitor when a device is removed from the USB port. Skill Requirements: - Proficiency in C++ programming. - Experience in developing Windows-based applications. - Understanding of device interaction with Windows OS via USB. - Previous experience in creating device detection software would be beneficial.

    €186 (Avg Bid)
    €186 Oferta mesatare
    37 ofertat

    ...POLYGON) 4) I want screen sending to be simple and display the message easily. 5) VPN and TOR options included with Blockchain proxy server option Transaction confirmed at 100% Transaction fees are maximum, priority for fast confirmation Cannot cancel transaction with Bitcoin server Works with all wallets 6) I want all crypto to be : A) Fully confirmed by the network B) Transferable and convertible C) Main balance displayed in the wallet D) This BTC or USDT can be split E) This BTC or USDT can be used for trading F) This BTC or USDT can be broken NOTE: GROS BONUS sur ( WU, BANQUE, ect.... ) ENVOYEZ-MOI VOTRE DEVIS SALAIRE ET BONUS SERONT ENVOYÉS AU DÉVELOPPEUR APRÈS LIVRAISON ET TEST DU LOGICIEL AUCUNE AVANCE SUR AUTRE PLATEFORME OU BESOIN AVANT LA LIVR...

    €2103 (Avg Bid)
    €2103 Oferta mesatare
    54 ofertat
    [C] POSIX threads and Mutex task 6 ditë left
    VERIFIKUAR

    This is a task. Analytical details will be given in docx in chat. We need a freelancer with proven experience and good expertise in systems programming using C, proficiency in POSIX threads and mutex. Familiarity with shell scripting is also essential. I will send requirements in chat budget: $75 USD deadline 20/5/2024

    €117 (Avg Bid)
    €117 Oferta mesatare
    14 ofertat

    Hi Jvs S., I noticed you posted a following project ( https://www.freelancer.com/projects/c-sharp-programming/Build-Web-Based-DICOM-Viewer/details )

    €9 (Avg Bid)
    €9 Oferta mesatare
    1 ofertat

    Hi Gaurav C., I noticed your profile and would like to offer you my project. We can discuss any details over chat.

    €56 (Avg Bid)
    €56 Oferta mesatare
    1 ofertat

    Hi Raj Kumar C., I noticed your profile and would like to offer you my project. We can discuss any details over chat.

    €232 (Avg Bid)
    €232 Oferta mesatare
    1 ofertat
    Call Centre Management App 6 ditë left
    VERIFIKUAR

    Please read the attached document. There is a hidden code in the document. You must include this code when bidding. No code means bid is deleted. Skills: MySQL ReactJS HTML/CSS C#

    €1226 (Avg Bid)
    €1226 Oferta mesatare
    133 ofertat

    ...Truth - Database) with the records from the bank. There might be discrepancies and part of the job is to find those discrepancies. Deliverables: A: Identify if the records from bank and database are matching B: Identify the discrepancies in the data C: State your assumptions D: We are a tech company and this is not a sustainable process. What are your suggestions on improving this process? Guidelines: A: Show your work - we'd like to see how you are using Google Sheets and other tools B: Feel free to use any AI tool if you think it'd help C: State your assumptions - we don't expect you to understand all that is going on but make reasonable assumptions and state them D: Source of Truth - Bank is a fairly straight forward sheet with one record each time BROK...

    €21 (Avg Bid)
    €21 Oferta mesatare
    19 ofertat
    Text-Based Game Development 6 ditë left
    VERIFIKUAR

    I'm looking for a professional game developer who can create a simple text-based game for Windows using Visual Studio or C++. The primary goal of the game is to entertain users. That being said, there are a few specific requirements the game should meet: - The game must be compatible with Windows possibly others - The graphics of the game should be simple and text-based. It is important that you are experienced in game development and familiar with Visual Studio or C++. Being able to provide examples of previous similar projects would be a big plus. If you believe you fit the bill, please reach out.

    €26 / hr (Avg Bid)
    MRS
    €26 / hr Oferta mesatare
    33 ofertat

    Hi Rajat C., I noticed your profile and would like to offer you my project. We can discuss any details over chat.

    €6 (Avg Bid)
    €6 Oferta mesatare
    1 ofertat