Vb net search active directory punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
...warehousing concepts, ETL development, data modeling, metadata management and data quality Strong knowledge of SQL running on SQL Server, MySQL, and Snowflake including but not limited to: extensive experience working with complex stored procedures, table definitions, and a proven track-record of performance optimizations and troubleshooting of SQL logic. Proficient at C# running on .NET Core and/or other similar .NET frameworks including but not limited to: writing Unit Tests and implementing algorithms and data structures Strong hands on experience in Microservices, RESTful webservices development in Java (Spring Boot or equivalent framework) Proficient at building intelligent solutions to complex problems. Experience using source control tools such as GIT Proficient at ...
My project require an expert who can effectively integrate Bitwarden with Active Directory (AD) and ELK Task features: Expected Skills and Experience: - Expertise in Active Directory setup, management, and integration. - Comprehensive knowledge of Bitwarden. - Proven experience in User Authentication system implementation. - Excellent problem-solving skills with a proactive approach. - Able to complete the project within the set time frame and budget. - Able to integrate bitwarden with ELK and some use cases Your proposal should include a brief overview of your experience with Active Directory and Bitwarden, and any similar projects you might have completed.
I'm looking for an assistant to help me with a few tasks. This is not your typical job as it's not boring. The tasks you will do are: - Transcribing videos: I use AI for this so it's very easy. - Google Search: I need you to look up lawyers/private investigators in Maine. - Facebook Stalking: I know it sounds weird but I need you to do some Facebook stalking. Don't worry, it's all professional. Your role will also involve gathering information from Google, so you must be comfortable with searching for relevant data across different platforms. Ideal Skills: - Video transcription experience is a plus but not necessary. I'm willing to teach you the AI tool. - Efficient at conducting Google searches and finding specific information, as well as being th...
I'm searching for an experienced designer to create a modern logo for my apparel sports, street wear and active wear company. No specific colour scheme or elements are predefined, giving you creative freedom in that regard. However, the logo must reflect a modern look and feel. Key Requirements: - Creation of a modern-style logo - Freedom of colour choice - No specific elements to be incorporated Ideal Skills: - Graphic design - Creativity - Knowledge about modern design aesthetics
...capable .NET developer to create a WebAPI using the Visual Studio template "WebApi Net core (Minimal api)". It needs to have Authentication and Authorization in place, using the X-API-Key. Key Requirements: - Authentication and Authorization: You need to enable X-API-Key based authentication and authorization for this WebAPI. - Data Model: The WebAPI will manage a simple 'City' table, performing basic CRUD operations. Expectations: - The X-API-Key should be hardcoded in the application. - The WebAPI should be developed using .NET 8.0 and the Visual Studio template "WebApi Net core (Minimal api)". - Data access should be implemented using EFCore. - Authorization should be handled through middleware. Ideal Skills and Experie...
I am seeking an experienced .NET developer to build a highly dynamic REST API using the .NET 8 framework. The API will be designed to manage interactions with a database using a single, generic controller capable of handling all database tables. This project will involve implementing advanced features such as column selection, filtering, sorting, pagination, and complex table relationships like aggregations and master-detail references. Core Requirements: 1. API Framework: The API should be developed using .NET 8. I am open to using either OData or GraphQL for the API architecture, depending on what the developer finds most suitable for the project requirements. Alternative suggestions are welcome for discussion. 2. Generic Controller: The API should feature a single...
I'm in need of a skilled professional to help me generate a comprehensive data set of manufacture part numbers instead of custom part numbers based on resell companies. The primary goal of this project is to accurately identify the sources of the products and their usage, which is in this case finding proper part numbers from the manufacturers. Key Responsibilities: - Conduct a reverse image search on a set of photographs and collect relevant details - Accurately identify the sources and usage of the component - Deliver a comprehensive data set containing the part numbers obtained I'm looking for a freelancer who has: - Proficiency in reverse image searching - Experience in data collection and management - Keen attention to detail - Ability to deliver accurate and high...
In need of a proficient script writer to extract specific business data from an online directory, specifically Myagedcare.gov.au. This project will need a freelancer that possesses: • Significant knowledge and experience in data scraping technology • An understanding of the structure and functioning of online directories • Keen attention to detail The successful freelancer will carry out: 1. Extraction of business data: I require accurate extraction of contact details and business names from businesses listed on the directory. 2. Specific Directory Focus: The targeted directory for this exercise is Myagedcare.gov.au. The end goal is to create a clean and organized database of businesses in the aged care sector. Prior experience with online...
I'm looking for a Facebook Ads expert who can help me generate leads. Key Requirements: - Experience with lead generation campaigns on Facebook - Proficient in targeting older demographic (65+) with high net worth - Ability to focus on a specific local area I'm in need of someone who can craft ads that speak directly to high net worth adults in a specific local area. The primary goal is to generate leads, so it's crucial that the ads are not only engaging but also have a clear call to action that encourages these individuals to express interest in my services. It's very important that the freelancer has a deep understanding of Facebook Ads, including the platform's ad targeting capabilities. Previous experience with similar campaigns targeting a s...
...developer to create a directory website focused on real estate projects. This website will be akin to a business directory but will be tailored specifically for the real estate industry. Key features required for this website include: - **Property Search:** Users should be able to search for various properties within the directory. This will involve setting up a robust search functionality and ensuring that search results are accurate and relevant. - **Listing Details:** Each property listing should provide comprehensive details about the property. This could include the location, size, price, images, etc. It's important that this information is clearly presented and easy to navigate. To successfully deliver this project, you shou...
The purpose of this project is to write Visual Basic .NET code that interacts with the PayPal API to generate payments What I need: that will: - Obtain the access_token using OAuth2. - Create a payment. - Execute the payment. will: - Retrieve the response triggered by PayPal and process it accordingly by determining if the payment was successful or not. - If the payment wasn't successful, display a message saying that no payment was made. - If the payment was successful, display the details of the operation returned by PayPal. If you want to participate to this project please copy/paste this sentence in your bid "I have been working with PayPal API and I have got proficiency in Visual Basic .NET"
...assist features. The system needs to handle up to 10,000 participants. • User profiles: Creation of user profiles is essential. Robust privacy and security for users should be ensured. • StreamYard Integration: User comments should display on StreamYard. Event hosts comments should post to the platform. • Video replay with live chat: Users should be able to replay video streams while maintaining active chat features. Ideal freelancer will have: • Experience with live streaming platforms • Proficiency with Social Media API integration • Demonstrated skills in designing secure user profiles • Experience with StreamYard or similar broadcasting platforms. The final goal is the creation of our own broadcast platform independent of Facebook/Youtube ...
I'm in need of expert assistance in pushing my Quotex trading themed YouTube channel to the top of search results. My channel hosts over 50 videos and has already had some SEO optimization done, but I need a seasoned professional to drive further growth and visibility. Expectations from this project include: - Conducting detailed SEO analysis on current content - Designing and executing an SEO strategy for improving rankings - Recommending changes and improvements to video titles, descriptions, tags, etc., and where required, boarding new SEO-focused content Ideal skills for this job: - In-depth knowledge of YouTube's algorithm and ranking factors - Excellent record in SEO strategy and implementation for YouTube channels - Familiarity and understanding of the Quotex ...
I am facing severe difficulties in operating my WordPress site hosted on AWS Lightsail. Speci...error on this website", which has begun appearing ever since I made some modifications to my website's theme. For this project: - I need an experienced WordPress developer with knowledge of theme modifications. - Proficient in troubleshooting and error resolution. - Knowledge of AWS Lightsail is a must. - Understanding of WordPress plugins to ensure no compatibility issues between the theme and active plugins. - Ability to prevent/ fix future occurrences of errors would be an added advantage. You will be required to uncover the issues causing this error, implement necessary solutions, and ensure the smoothly running website post-fixing. I'd appreciate it if the job is do...
I'm looking for a skilled developer to create a business website, and I'm open to using either PHP or .NET. Key requirements for this project include: - Implementation of a robust and user-friendly payment gateway integration for seamless transactions. - Integration of a feature that allows businesses to list their business for sale listing on the site. Your experience with development and payment integration will be crucial. Please share relevant experience and approaches in your proposal.
...config file. - There are also a few directories which need to be created under /etc/datadog-agent/conf.d/ and files which need to be added into these. For the purpose of this create the directory /etc/datadog-agent/conf.d/mysql.d/ and add under it a file called . The file will be in the same directory as terraform script. - After configuring datadog-agent, the service needs to be restrted - Create a folder /var/log/my_log_folder and ensure that it's owned by ubuntu:ubuntu with read/write permissions - install a service under /etc/system.d/system -- effectively copy a file from the same directory as terraform script to the host and reload config ; this should install a service which then can be configured via systemctl command. - I need to be able to SSH into ...
...with extensive C++ knowledge to create a custom grep application. The application should utilize pipelined threads and semaphores and have capabilities to search files in the current directory for a specified string. Look at the attachments for the Project Description and the producer consumer semaphore C++ example. Key Features: - Impressive understanding of thread and semaphore pipelines is crucial. - Recursion into sub-directories as a part of the application's functionality would be a bonus. - Filtering options based on factors like file size, user id, and group id are needed. - Upon discovery of a match, the app should continue the search and the total number of matches should be displayed on the last line of output. This isn't just about creating ...
As a business owner, I need supplementary support for my web presence efforts. Traits I'm looking for in a freelancer include proficiency in SEO and attention to detail, in order to accurately manage the specifics of directory profiles. Your main task would be to handle a list of directories I provide, where you'll verify if my business has an existing profile. If not, your job will be to claim or create one. One of your responsibilities also involves filling out these profiles with several specifics: * Contact information * Business description * Website URL * Social links * Hours * Any other relevant details These tasks should be completed promptly and efficiently, as I would like the project to be completed ASAP. Prior experience as a virtual assistant or in SEO opti...
I'm looking for a proficient Python developer to create a script that can efficiently scrape active IPs from a text file I will provide. The following specifics are required in this project: - The Skill-set: Strong Python programming skills, experience in IP scraping and working with text files would be an advantage. - Task Details: You need to extract the 'Activity Data' from these IPs. Profound knowledge in network protocols is a must-have. - Output Handling: The activity data extracted should directly be written to a text file. A clear understanding of FileIO operations in Python would be crucial. A successful completion of this project might lead to more future collaborations. I'm looking forward to seeing your proposals.
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
Due to time and resource constraints, I need to migrate a component written in php (symphony) to Golang. The part on github relating to services towards the DB (MongoDb) and the new REST APIs (written in Golang) to access for interfacing is already active. The system will only have to execute queries on MongoDb (via Service) and render in twig template. The repository layer and service and repository are already developed in golang and will be provided. Configuration files are ready. As well as indications on the function to be translated into Golang. GIT access will be via wireguard VPN on the development environment Please contact us only if you have experience with Golang or C++: to avoid wasting time We can give you advanced technical support and explain the logic of the pr...
...comprehensive directory of therapists and autism specialists located in London. This project encompasses a wide array of therapy disciplines as well as top specialists in autism treatment for children. The ideal candidate should possess excellent research abilities, have a strong understanding of the healthcare sector, and be adept at accessing and verifying professional credentials and contact details. Responsibilities: Systematically collect and verify contact information and qualifications of therapists and autism specialists, ensuring that all data is up-to-date and accurate. Utilize a range of sources such as professional healthcare directories, medical institutions’ databases, specialized LinkedIn searches, and other reliable internet resources. Organize data into a...
Job Overview: We are seeking a detail-oriented and experienced researcher to compile a comprehensive directory of leading doctors specializing in autism recovery for children across London, India, and the US, this list must be backed up with evidence of the doctors pedigree and why they are bated as one of the best. As well as a separate list of therapists based in London maximum of 25 in each discipline both lists is to be contacted to try and arrange an appointment so email and tel number needed . This project requires exceptional research skills and a strong medical or healthcare background. Project Scope: The researcher will create two distinct lists: one featuring top doctors specializing in autism recovery for children in three major global regions, and another listing various...
I'm in need of an experienced .Net developer, with solid skills in MSSQL and C#, who can effectively handle front-end development tasks in my POS terminal project. Your primary tasks will be: - Implement business logic based on defined user stories. - Develop the user interface of the POS terminal using C# and associated .NET technologies. - Integrate the POS terminal with MSSQL database for data storage and management Ideal skills and experience: - Proficiency in .Net, MSSQL, and C#. - Previous experience in front-end development. This role requires both technical expertise and keen attention to detail. I am looking forward to your innovative solutions to meet our project requirements.
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
I'm in need of a professional who can help me improve my search engine rankings through credible backlink building. The backlinks should come from a niche relevant to Business websites, and should have a domain authority (DA) between 30-50. My maximum budget for per link is 100 to 150 INR. And I need 65 to 100 live links (It will be great if its follow and indexed links only). Without live link or indexed link, I will not release the milestone or payment. Note: Links should be live and active. I will provide 21 URLs in starting (5 Backlinks per URL I need). I have complete backlinks database of Per URL. Will share screenshots as well. I will give you one month of time, before 31st May, you need to complete this task and submit reports of live links. Key requirements:...
I'm requiring an experienced deployment specialist for Odoo 17 on Google Cloud. As a company owner, I possess an active Google Cloud account hence you won't need to facilitate that. For the database system, we'd like to incorporate MySQL, necessitating a strong knowledge in this area. Key skills needed: - Familiarity with Odoo 17 - Expertise in Google Cloud operations - Proficiency in MySQL configurations Cease this opportunity to work on a highly professional project and bolster your profile.
I am in need of an experienced full stack developer who is well-versed in .NET and Angular to assist with the backend and frontend development of my project. Essential Tasks: - Involvement in both backend and frontend development processes - Providing valuable insights during project reviews Key Skills: - Strong competence in .NET and Angular - Proven experience in full stack development - A strong grasp of cloud technologies is advantageous - Excellent communication skills, as understanding and following project requirements are crucial Project Timeline: - There is no strict time frame for completion of this project. We value quality deliverability and careful attention to detail above speed. Ideally, you have a portfolio of previous projects to demonstrate your com...
I'm seeking a skilled developer with expertise in .NET and Angular to take part in my ongoing web development projects. The main goal of the project is to enhance an existing application. Requirements: - Proficiency in .NET for backend development - Strong experience with Angular for frontend development - Excellent understanding of SQL Server and MongoDB databases - Previous work with DevExpress is essential Your responsibilities will include: - Developing APIs using .NET for enhancing the application - Integrating Angular for improving the frontend - Ensuring seamless operation with SQL Server and potentially MongoDB Ideal candidates should have a strong understanding of web development and be able to contribute effectively to enhancing the current state o...
I want to change jobs and I am looking for specific positions that match my profile. Due to my current engagements, I don't have enough time to research all HR job posts on the net, so I am looking for a skillful Recruitment Specialist and HR Generalist. The main sources of info would be LinkedIn and Indeed and other job platforms - we will discuss. My requirements for the position are very specific. I have a LinkedIn profile. I research myself too, but I feel I don't put enough time. The task is to find jobs posts matching my profile and the requirements that I will provide, and to input all the results in a spreadsheet. Work time: once a week for about 2 hours, or twice a week for about 1 hour. Required Skills: - Prior experience in HR or recruitment - Much experi...
I need a professional to scrape specific details from a website directory for a one-time project. - Specifics: The data of interest includes the company names, their URLs, and their expertise. This information is laid out in rows on the website. - I wish for the freelancer to carefully extract this data, ensuring no errors or omissions are made. - The final output is essential to be in a CSV file format. I require this scraping to be done just once, and I do not foresee a need for ongoing scraping after this initial task. As the data is crucial for my business development, I am seeking someone who can deliver accurate and complete results in a timely fashion. Prior experience with web scraping and proficiency in data management are highly desirable.
Hi, Job Title: Senior Developer - SQL Se...business intelligence and data analytics requirements. Tasks involve creating data models and developing multidimensional cubes. Key skills required: expertise in MS SQL Server Analysis Services (SSAS) Tabular and Multidimensional. Proficiency in TSQL for writing performant queries is essential. Experience with data visualization and reporting tools is highly valued. Additional knowledge of Excel and .Net development is advantageous. Strong problem-solving abilities, excellent communication skills, and a collaborative mindset are desired traits. Developer has to be at the ON SITE Dubai office. - Work Location - Dubai - Number of Working Days - 6 days ( Monday to Friday ) - Number of Working Hours - 10hrs per day - N...
...first We are in search of a proficient Laravel/PHP developer to assist in the development of APIs for our upcoming matrimonial app. The backend infrastructure is based on Laravel, and we require the creation of several API endpoints to power core functionalities of the application. Notification API: Enable notifications for user interactions and events within the Code: Implement coupon code management for user promotions, including creation, validation, and : Develop APIs to manage user messages, including sending, receiving, deleting, and reading Active/Online: Track and display users' last active time and online Match: Calculate similarity scores between user profiles to facilitate Active User Activity:
I am seeking the developer with advanced skills in API implementation, with specific experience with the BnP Paribas' API structure, as well as a strong proficiency in C# .NET. Project duration 3 months. Spoken language Greek. Key Responsibilities: - Establish a robust connection between our application and the BnP Paribas via their API. - Ensure successful transmission of specific data, Cash Account Info, Securities Account Holdings, Settlement Status, Transactional – FX.. Required Experience: - Strong proficiency in C# .NET - Proven experience in API Integration, preferably with BnP Paribas - Knowledge of JSON data format - Proven ability to work according to specifications and deadlines - Ability to test and troubleshoot the integration This project involves...
...seeking a skilled developer to create a web application using .NET Core. This role involves a primary focus on building a robust, user-friendly web app. Ideal Skills and Experience: - Proficiency in .NET Core - Previous experience with web application development - Understanding of best practices in software design - Familiarity with integrating Payment Gateway APIs - Strong problem-solving and communication skills Key Deliverables: 1. Develop a web application using .NET Core that meets our specifications and requirements. 2. Implement Payment Gateway integration within the application for seamless transactions. 3. Ensure the web application is optimized for performance and is secure. If you have a proven track record in building .NET Core web applicatio...
Hi there, Please check recently great results and client appreciation - To ensure your site gets the...Optimization 11. Optimization of external Links 10. Analysis of Broken Links 11. Page Content Optimization 12. Fix Canonicalization error 13. Website URL Redirection 14. Sitemap Optimization SEO (OFF-SITE OPTIMIZATION): ✔ High Quality Backlinks 40+ Domain Authority ✔ Submission of Social Bookmarks ✔ Article Submission ✔ Classifieds Ads Post ✔ PDF Sharing ✔ Image Sharing ✔ Business Listing ✔ Directory Submission ✔ Web 2.0 ✔ Blog Promotion ✔ Profile Link Creation ✔ Forum Posting Submission ✔ Local Citation Backlinks ✔ Syndication Submission Chat Now.. Thank You, Climax SEO
Here is a list of zip files on a US Govt website. You must write a Python program that uses a network library to download each zip file on this site, then find each .csv file in the zip archive, and copy each .csv file in each zip archive to a hard drive directory on the local windows machine. The directory will be "C:/MedicareDownloadFiles". The files cover the years 2017 to 2024. You may not hardcode file names ... you must extract the filenames from the above https URL. The fee for this will be $30. You must have it done within 60 minutes. Thanks for participating!
...import/export customers would be great) (from Excel file) Item/Product: (Product Category, Product name, SKU, Price) (Option to import/export Products from Excel file) would be great) Workflow would be: Login to App (email and password) (Option to stay logged in) (Option to reset password through email) Flow 1. Customer calls in to place an order. 2. Employee will search for customer by first or last name or phone number of customer. (Search field that searches trough either phone number, first name or last name) If not in system Employee will “Add new customer” (Pop up in same window without returning from “New order”) 3. Employee will select order pickup date from Calendar field. 4. App will automatically add Date and time order is placed.(Fo...
I am seeking a virtual personal assistant based in Croatia. This communication-focused role will involve various tasks, primarily offering personal assistance to me in addition to some administrative support tasks. While not required, proficiency in Microsoft O...personal assistance to me in addition to some administrative support tasks. While not required, proficiency in Microsoft Office Suite and experience in calendar management will be viewed favorably. The ideal candidate should be highly organised, dependable and detail-oriented. A high level of English proficiency is required and fluency in Croatian language is desirable, but not necessary. Honest, pro-active and comfortable in a remote role, the preferred person has a can-do attitude and a keenness to grow in a supportive en...
Here is a list of zip files on a US Govt website. You must write a Python program that uses a network library to download each zip file on this site, then find each .csv file in the zip archive, and copy each .csv file in each zip archive to a hard drive directory on the local windows machine. The directory will be "C:/MedicareDownloadFiles". The files cover the years 2017 to 2024. The fee for this will be $30. You must have it done within 60 minutes. Thanks for participating!
I need a seasoned ASP.NET VB developer with a strong background in updating existing applications. You will be responsible for enhancing and improving the functionality of our current system. Ideal Skills and Experience: - Proven experience with ASP.NET VB - Competence in updating and maintaining existing applications - Strong problem-solving skills - Excellent communication and teamwork abilities Your application should clearly demonstrate your experience with updating existing ASP.NET VB applications. Please don't hesitate to include links to relevant past work.
Hi there, i I need a help to show Star Rating On Google Search Results for my website pages. For example if you search for a word 'Faceit Boosting' when my site is displayed in google search results i want UNDER the page title/meta text to show 4/5 Yellow Stars so viewers can easily find my link and click on it. I will show in image example
I'm looking for a skilled developer to create a C# web application. Key Requirements: - Fluency in C# programming language - Proficiency in web application development - Experience with .NET Core, Xamarin, or Unity frameworks is a plus - Familiarity with web application technologies and best practices It's a plus if you have prior experience in building web applications, but not necessary. The most important aspect is your ability to understand and implement the project requirements effectively. A good grasp of C# and web programming is a must.
I'm in need of a conversational AI app that can provide companionship and ease loneliness for its users. The app should utilize lifelike avatars for a more engaging experience. Key Features: - Active Listening and Empathy: The AI should be able to actively listen to users and empathize with their feelings. - Engaging Conversation Prompts: The app should have a variety of conversation prompts to keep users entertained and interested in the dialogue. - Emotional Support and Encouragement: The AI should be able to provide emotional support and encouragement to users, helping them feel better and more positive. Avatar Design: - The avatars in the app should be realistic human avatars. These avatars should be designed to look and behave as human-like as possible, enhancing the in...
I'm looking to improve the search functionality of my website by adding a custom search field to the Avada Theme search form builder. As a proposed plan, the modification should: - Include additional search criteria which will refine the search capabilities of the site, creating a more user-friendly experience. Ideal candidate for this job should: - Be proficient in WordPress and specifically experienced with the Avada Theme and form building. - Be able to provide creative solutions on the possible type and purpose of the custom field since the specifics are yet to be decided. - Be communicative and able to work with me to determine the optimal solution for my site. Excellent English skills are a must. This project will not only enhance the f...
As an entrepreneur aiming to reach a broad demographic - Millennials, Generation X, and Baby Boomers, I require a skilled professional to step into a versatile marketing role. This project requires daily activities across a range of duties. Key Responsibilities: - Daily social media marketing on Facebook and Instagram, targeting all three demographic groups. - Cold calling lea...marketing campaigns. - Designing marketing materials that resonate with my target audience. Ideal freelancer should have: - Proven experience in social media management. - Excellent communication skills for effective cold calling. - Proficiency in email marketing. - An eye for design and creation of promotional materials. Please note that social media posts must be scheduled once a day across all active ...