Clear browser cookies vb net punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I'm building a chrome extension for ghost browser (chromium based) that needs to extract an a few values from another ghost plugin that injects some data into every new tab that opens. You can create new identities with ghost browser and give them a name. When the new tab opens in the new identity one of ghost browsers plugins injects an array of data. into the page and can be viewed in the console. I'd like to extract the ID, Name and Color values that it injects and store them in my chrome plugin but haven't been able to successfully access. Building the plugin I'm ok with but need help accessing these values. Here is the array that gets injected into each tab: { "active": {}, "bypassed": false, "info": [], "i...
...understand the requirements, best practices, and strategic approach to initiate this project. Objective: To gain insights and guidance on starting with PowerBI reporting, understanding the necessary requirements, and developing a strategic plan for implementation. Duration: 30-minute consultation call Experience: Proven experience with PowerBI report creation and strategy development is required. A clear understanding of the steps required to start with PowerBI reporting. Identification of key requirements and tools needed. Strategic advice on best practices and methodologies. A high-level roadmap for implementing PowerBI reports. Requirements: Extensive experience with PowerBI architecture and report creation. Strong communication skills and ability to explain complex concept...
I'm in need of a developer proficient in Python who can create a video tutorial. The tutorial should showcase the process of building a user authentication login page for a web application using the Microsoft Graph API...is a must, as the tutorial is centered around this language. - Familiarity with Microsoft Graph API: The ability to leverage the Microsoft Graph API for user authentication is essential. - Video Creation: While I'm not looking for a professional video maker, the candidate should be able to record, edit, and produce a clear and engaging tutorial. The ideal candidate should possess a developer’s eye for detail and the ability to explain complex technical processes in a clear and understandable manner. Experience with educational or tutorial co...
As a professional in computational chemistry or biophysics, ...practical implementation and problem-solving Ideal Experience and Skills: - PhD in Computational Chemistry or Biophysics - Has publications in international journals - Strong background in Protein structure prediction, Molecular simulations, Coarse-grain modeling - Proven experience in mentoring or teaching - Excellent communication skills and the ability to convey complex technical information in a clear and concise manner Your guidance will be crucial in helping me deepen my understanding of these topics and improve my practical skills. I'm particularly interested in a structured, systematic approach to learning and problem-solving in the area. Looking forward to finding an experienced mentor to guide me throug...
This is for freelancers located in the U.S. ONLY. I need an Adobe Acrobat Pro expert to “Embed Videos” and “Create Links” inside a PDF document using Adobe Acrobat Pro. Just to be clear, not hyperlinks to other files outside the PDF document, not hyperlinks to websites, webpages or web located videos. When complete, and the PDF document is forwarded to another individual, they need to be able to "click on" an icon in the document and have the video play. We are a forensic investigation company and often have legal cases where these types of efforts are needed. Unfortunately, the documents cannot be sent to you. You will be working remotely on a computer in our office. The tasks pay $50 per hour with a one hour minimum. In short, if it takes ...
Change information such as mobile identifiers, platforms, etc
I'm in need of an experienced 3D artist who can crea...air pruning: The tree's roots growing and being air pruned once they come out of the pot. - Root texture and color: The texture and color of the roots need to be accurately represented. - Pot material and design: The type of pot and its design should be visible in the render, and be realistically depicted. - Leaf and bark detail: The leaves and bark of the Kunuka tree should be distinct and clear in the final render. Ideal Skills: - Proficiency in 3D modelling and rendering software. - Experience in creating realistic botanical renders. - Understanding of marketing material requirements. - Attentive to detail, especially in terms of texture and color accuracy. - Creative mindset to bring the scene to life while ...
I am in need of a WordPress website developer to create a 3-4 page static site for my company. Key Requirements: - No specific theme: I don't have a theme in mind, so I would...essential details. It should be structured, easy to navigate, and visually appealing. Skills and Experience: - Proficiency in WordPress: You should have significant experience in developing WordPress sites, especially for business purposes. - Design Skills: A good eye for design and aesthetics is crucial in order to ensure the site is visually appealing and professional. - Strong Communication Skills: Clear and open communication is a must for this project to ensure that my ideas and vision are accurately translated into the website. Please share your previous work and an overview of your approach t...
I'm using Star Wars Battlefront 2 (2017) on PC and require custom modded aesthetic skins. This will be based ...exclusively for my personal use and not for public distribution or showcase Ideal Skills and Experience: - Proficiency in game design and modding - Prior experience with creating custom game skins, especially for Star Wars Battlefront 2 (2017) - Strong understanding of the game's mechanics and requirements for custom content - Ability to deliver high-quality, bug-free work within a specified timeline - Clear communication skills, to ensure that my requirements are met accurately Please note that I'm looking for a professional who can create a top-notch custom skin that enhances my gaming experience. If you have the expertise and creativity for this task, I...
I am in need of a skilled 3D designer who can create a detailed design of a small commercial car workshop interior. Key Requirements: - The 3D design should accurately capture the layout and features of a small-sized car wo...needs of a car workshop. Ideal Skills and Experience: - Proficient in 3D design software (e.g., AutoCAD, SketchUp, Blender) - Experience in designing commercial or workshop interiors - Understanding of layout optimization in small spaces The successful freelancer will deliver a 3D model that can be used for visualization and planning purposes. This model should be of high quality and provide a clear representation of the space. If you have relevant experience in this field and can meet these requirements, I would be delighted to discuss the project further...
I'm seeking a skilled professional to create a comprehensive pitch deck for my real estate project, with the primary goal of attracting investors. Key Points: - The target audience for the pitch deck is primarily real estate investors. - The pitch deck should include detailed market da...deck is primarily real estate investors. - The pitch deck should include detailed market data, financial projections, and unique selling points. Ideal Skills: - Proven experience in creating successful pitch decks for real estate projects that have secured investor funding. - Strong understanding of the real estate market and investment landscape. - Proficiency in presenting financial data in a clear and compelling manner. - Ability to articulate unique selling points and competitive advantag...
I'm looking for a professional who can turn a Pine Script Indicator into a Trend Following Strategy on TradingView. The indicator is written in Pine Script, and the end product should offer clear entry and exit signals based on the indicator's moving averages. Key Deliverables: - Convert the existing Pine Script Indicator to a comprehensive Trend Following Strategy. - The strategy should utilize moving averages as the primary factor for determining entry and exit points. Ideal Skills & Experience: - Proficiency in Pine Script - Strong background in trading strategies, specifically trend following - Experience building and implementing trading strategies on TradingView - Familiarity with moving averages and their application in trading strategies.
I need an AI agent script that is browser based without a local computer install that will do two things. 1. Research current job postings on various job platforms based on my keywords and gather any emails as well and 2. Gather email for those related postings that did not have the emails in the posting by researching the agents. So these are either two agents or two tasks. I need the output in a csv file with the name of business, job posting link, job category, name of contact if exists email address, phone number if exists. I only want the line saved if there is an email address. Again, I want something I can run from a browser without having to install python or anything in my computer. Please give a price for completing this project. If necessary I can provide acces...
...involves football, basketball, soccer, and more sports images that need your magic touch. Here's what I need you to do: * Color correction: Focus on enhancing the pictures without over-saturating or washing out the images. * Cropping and resizing: Adjust the size for optimal balance and composition. Make sure the action is always the focus and fits perfectly. * Removing background distractions: Clear out any unwanted objects, enhancing the subjects and actions in the picture. The final look and style should be dramatic with high contrast and vibrant colors. Achieving intense, vivid visuals that spur excitement is crucial for this project. Skills in Adobe Photoshop or similar, and experience in editing sports photos are desired. Understanding of sports and action capture w...
I'm looking for a talented data analyst to help me leverage MIRO for a deep dive into our various types of data and generate actionable insights. I need the work done quickly, so please be prepared to jump right in. Key skills and experience require...quickly, so please be prepared to jump right in. Key skills and experience required: - Previous experience in data analytics, particularly using MIRO and analyzing a range of data sources. - Ability to identify trends and patterns, discover correlations between variables, and make data-driven recommendations. - Excellent communication skills and the ability to present complex findings in a clear, understandable manner. - A proactive and fast-paced work ethic- the ability to deliver quality work quickly, without compromisi...
...radiology in a manner that is easily understood by a non-specialist audience. - Incorporate intriguing and relevant facts, statistics, and anecdotes to maintain audience engagement and understanding throughout the speech. - Ensure the speech is well-structured, with a clear introduction, body, and conclusion that effectively convey the message and key takeaways. Ideal Candidate: - Proven experience in speechwriting, particularly in the area of healthcare or a related field. - Proficiency in conveying complex ideas in a clear, engaging, and accessible manner. - Understanding of the principles of effective public speaking and audience engagement. - Familiarity with radiology or a strong willingness to conduct thorough research to understand the topic. If you have the skill...
I need an expert for rendering traditional architecture in 3D. The main goal is to create an architectural visualization that accurately reflects traditional design elements, while not being overly detailed. The rendering should be clear enough to understand the overall structure of the architecture. Ideal Skills and Experience: - Proficiency in 3D rendering software - Experience in architectural visualization - Strong understanding of traditional architectural design - Ability to deliver medium level of detail in rendering
...Scheduling: The tool should also have a built-in feature that enables easy and efficient interview scheduling. Preferred Resume Screening method: - Keyword Matching: A system to match keywords in resumes to job requirements - Machine Learning Algorithms: An algorithm to predict candidate suitability based on historical data Platform: - Web-based: The software should be accessible via any web browser for ease of use and accessibility - Mobile App: A mobile application should also be developed alongside the web version to allow recruiters and candidates to access the service on the go. Ideal skills for this project include: - Proficiency in AI and machine learning algorithms - Experience in recruitment software development - Knowledge of LMS and healthcare recruitment practice...
Merhabalar elimde PHP bir web sitesi mevcut bu siteden girilen Bilgileri android webvirew ile çekiyorum komlpe sayfayi örneğin Instagram profil resim vb gibi eklemeler yapınca geçerli uygulamaya yonlendirmiyir sadece Türkçe dilini bilen arkadaşlar irtibata gecsin
I am seeking a professional WordPress developer who can address the issue that has recently emerged on my site's admin login page, preventing me from accessing my dashboard. The issue started less than a week ago and I have not ins...ago and I have not installed any new plugins or themes, so it seems like the problem lies within the site's core functionality. Ideal candidates should have: - Proficiency in WordPress, specifically with troubleshooting and fixing login-related issues - A good eye for detail and the ability to work independently - Strong communication skills to be able to discuss the changes made and provide a clear explanation for the issue. If you think you're the right freelancer for this job, please get in touch and let's get my WordPress a...
...analysis. The data is varied and comprehensive, including but not limited to customer demographics, product descriptions, and pricing information. Key Responsibilities: - Thoroughly examine the provided businesses in the spreadsheet - Extract and analyze various attributes, such as customer demographics, product descriptions, and pricing information - Summarize and present the information in a clear, concise manner - Provide suggestions on the potential opportunities or challenges based on the data This project requires an individual who is meticulous, analytical, and has a strong understanding of business operations. The ability to interpret raw data, identify trends, and draw meaningful insights from the information is essential. Experience in market research and business an...
I need assistance in creating a Wikipedia entry in the History category. The main goal of this entry is to educate the public. The focus here is on presenting a general outline rather th...Requirements: - Create a Wikipedia entry in the History category. - Ensure the content is suitable for educating the general public. - Focus on providing a broad, yet informative overview, rather than delving into specifics. Ideal Skills and Experience: - Experience with creating and editing Wikipedia entries. - A strong background in history and expertise in condensing complex information into a clear, concise form. - Understanding of the Wikipedia guidelines and principles of neutrality, verifiability, and reliable sourcing. - Good command of the language to ensure the entry is well-written and...
I am seeking fast-paced professionals to pitch my luxury catering company based in Qatar, targeting high-net-worth individuals, corporate clients, and wedding events. Key Requirements: • Expertise in Marketing Strategies • Familiarity with the catering industry • Understanding of the needs of high-net-worth individuals, corporate, and wedding events Particulars: • My company specializes in International and Middle Eastern fusion cuisine. • Ideally, we generally cater for a maximum of 50 guests per event. Desired Skills: • Excellent communication skills • Previous experience in marketing or catering, specifically within luxury services • Creativity in developing unique, targeted pitches • Understanding of high-end clientel...
...Invoice page, I should be able to add an invoice details, and if it's related to a contract or purchase order, I should be able to add the Contract/PO ID, from the dropdown list. The dropdown list should be searchable to easily find a contract/po. Once the invoice processed it invoice should be shown in the master list and also in the Contract/PO list under it's elated contract or PO. To make it clear, when I go to the Contracts/PO list and when I open a specific Contract/PO I should also be able to see all of the invoices related to that Contract/PO. Also, the amount of the invoice should be deducted from the FundRemaining of the contract. Same if it’s a PO invoice. Also I should be process invoice if they are not related to a Contract/PO as well. As I mentione...
I'm in need of someone skilled in Microsoft Excel for a couple of tasks. - **Formatting:** Firstly, I require assistance in formatting the spreadsheet. This will include ensuring that the data is clear and easy to read. I would like the spreadsheet to look professional. - **Formula checking:** While the formulas used are not too complex, I still want them to be checked thoroughly for accuracy and consistency. This will mainly involve basic arithmetic operations. I'd appreciate it if you have a background in financial analysis. It would be helpful to have a good eye for detail as well.
...work - Proficiency with video editing software and ideally experience creating text overlays - A creative eye and ability to tell a compelling story through video Looking forward to turning these clips into a powerful promotional tool - let me know if you're up to the task. Instructions for Freelancer Initial Review and Audio Improvement Enhance the audio quality throughout the video to ensure clear and consistent sound. This includes reducing background noise, balancing audio levels, and ensuring voices are easily heard and understood. Video Segmentation and Merging Intro Section: Start the edited video with Amber's introduction: "If Nextwork achieves the mission that it's on track to achieve, then places like India will have the same ratio of doctors to...
I'm seeking a social media professional who can assist with my Instagram ad posting issue. Despite not receiving any error messages, I've been unable to post Instagram ads lately. I'm looking for someone to identify and resolve the root...posting. - Ensure smooth ad posting: Make sure the issue is resolved comprehensively to avoid future hiccups. Ideal Candidate: - Proven experience with Instagram ads: I need a professional who has a solid understanding of the platform and its ad posting mechanisms. - Troubleshooting skills: Ability to identify potential issues and implement effective solutions. - Strong communication: Provide clear updates on the progress and potential solutions. - Commitment to timely delivery: Resolve the issue efficiently to minimize disruption t...
I'm looking for a talented developer to create a comprehensive video software demo that can showcase our product for marketing purposes. Note: The software is not done yet. So you will have to use referen...for Black-Americans. Key features to display 1. crowdfunding platform, which allows people to raise money for creative projects and people to pledge money to projects 2. entrepreneur matchmaking- which allows entrepreneurs to connect with team members 3. online courses - to educate people on investment and other money-making topics Requirements: - The demo should be user-friendly, with a clear interface that highlights our product's key features and benefits. - The software should ideally be designed to be easily navigable and able to capture the attention of ...
I'm seeking a professional with expertise in Visual Software to adjust my company's quote template. Key responsibilities would include: - Adding permanent text, specifically our company's terms and conditions, to all of our quotations. Your skill in precision and attention to detail will be key as we need th...company's terms and conditions, to all of our quotations. Your skill in precision and attention to detail will be key as we need this text to always appear directly below the quote details. Ideal freelancer should have: - Proficient skills in Visual Software - Experience in document formatting - Strong attention to detail Your job will ensure our terms and conditions are always visible and clear, enhancing our business professionalism and clarifying...
SmartiCo is hiring mexican freelancers for audio recordings job Key requirements: - Native Mexican Spanish speakers with clear and engaging delivery - Experience in voiceover work, especially for radio - Ability to maintain consistent audio quality throughout recordings - good English level The duration and specific use of the recordings will be provided upon hiring. I'm looking for top-notch professionals who can deliver high-quality, engaging narration. Please provide samples of your past work in your bid.
...Expectations: - Genuinely engaging, fun, and vibrant design that stands out, in order to capture parents' attention - Clear presentation of the schedule and insightful descriptions of the activities - Design should cater to the 5-10 age group and their parents Ideal skills for this project: - Seasoned graphic designer with experience in children-oriented designs - Excellent communication skills to understand the event details and requirements - Awesome creativity to make the flyer colorful, fun, and engaging - Keen eye for details to make sure all the necessary information is included - Strong organizational skills to highlight the schedule and activity descriptions in a clear, understandable manner Please submit your bid with any relevant examples of your previous...
I am seeking an experienced, talented individual to create an accurately measured floor plan based on a sketch, and perhaps 3d renderings if we align on the 2d. This project will require the inclusion of the following primary facilities: - 4-6 Treatment rooms - Sauna or steam area and day spa space - single-stall ...AV - front desk - Spa Retail area - lockers - back office area for laundry, storage, and staff break If you have innovative and creative ideas beyond my sketch to further enhance the floor layout to attract more customers, they are more than welcome! You will be working closely with me to design a floor plan that truly captures the essence and objectives of the spa. The final design should be clear and accurately measured out so I can see how much sq footage I may nee...
...(DCF), Gordon model, and residual income. The project should be conducted with a 5-year timeframe in mind. Key Deliverables: - Thorough valuation of a listed company using DCF, Gordon model, and residual income - Clear and well-structured report detailing the results and rationale of the valuation - Analysis that corresponds to a 5-year timeframe Ideal Skills and Experience: - Strong financial analysis background with experience in valuations - Expertise in using DCF, Gordon model and residual income for company valuation - Ability to present complex financial information in a clear and concise manner - Understanding of listed companies and their unique valuation considerations The successful freelancer will be able to deliver a high-quality, timely valuation that prov...
I am in need of a professional website developed to showcase my academia-focused content. The site should be specifically designed to highlight my research publications. Key Features: - Display of Research publications: These should be presented in a clear, easily navigable way. Each publication must have its abstract summary and a link to access the full text PDF. - Organization: The publications should be organized by research topic, allowing visitors to quickly navigate to their areas of interest. Ideal skills for the job: - Web Design: You should have a portfolio demonstrating your ability to create professional, clean, and user-friendly sites. - Content Management: Familiarity with content organization is crucial, specifically in handling academic or research materials. Over...
I'm in need of a skilled and experienced website developer to create an informative platform about the immigration services our agency provides. - The website's primary goal will be to provide detailed information about our immigration services. It should be clear, concise, and user-friendly. - It needs to have the capability to collect client's documents and information. This includes a secure and organized method to receive and store sensitive client data. - The site should also provide an online platform for visa and citizenship applications. Key Skills: - Proficiency in website development - Experience with e-commerce websites - Strong understanding of information security and data privacy - Familiarity with visa and citizenship application processes is a plus ...
... The project aims to provide insights into the logistics and business operations of several industries including Healthcare, Retail, Manufacturing, and Education. Key Tasks: - Data Cleaning and Preprocessing: Efficiently handle large datasets in multiple languages for optimal data quality. - Descriptive Analytics and Reporting: Create insightful reports on the logistics and business data in a clear, concise and actionable manner. - Predictive Modeling and Forecasting: Utilize predictive analytics to forecast future trends and make informed strategic decisions. Ideal Candidate: The ideal candidate should possess: - Proven experience in data analysis, particularly in a multilingual context - Strong understanding of logistics and business operations - Proficiency in English, Spani...
Need to rectify observations in my report. I'm seeking a skilled SPSS expert capable of providing detailed descriptive statistics and an executive summary based on the data analysis. You'll need to incorporate both visual charts/graphs and a comprehensive written report to effectively communic...the results. Key requirements and skills: - Proficiency in SPSS software - Ability to perform thorough descriptive statistical analysis - Experience in creating visual charts/graphs - Strong report writing skills, particularly in delivering detailed analysis along with an executive summary. The successful applicant will need the ability to interpret data accurately and present findings in a clear and compelling manner. Experience in similar projects within the social sciences fi...
...breakdown into the invoice. • Layout adjustment: I would like the overall layout of the invoice to be adjusted to reflect these additional changes, and accommodate a binding clause. The ideal candidate will have experience with graphic design, especially layout adjustment. Previous work with invoice design is a plus, but not mandatory. Your understanding of how to present numbers and breakdowns in a clear and streamlined way would be highly beneficial....
I'm seeking a Laravel Livewire developer who has experience worki...Report: - The ledger report should have a user-friendly interface and should be able to filter transactions based on specific criteria. - Transactions should be classified as either debit or credit, which should be reflected in the report. Deliverables: - A functional ledger report integrated into the Ultimate POS script with the ability to classify transactions as either debit or credit. - A clear and well-organized codebase that allows for any future modifications to be easily implemented. It's important to emphasize that the classification of debit and credit transactions in the ledger report should be carefully discussed and designed. Your input on how these transactions should be classified will be ...
...looking for a skilled designer who can create a modern and sleek postcard mailer for my residential service company. This design will serve as the primary method of advertising our services to homeowners. Needs to have mailing label per the attached instructions. Key Requirements: - Visual Appeal: The postcard should be designed with a modern, sleek look that will catch the eye of homeowners. - Clear Messaging: The design should clearly communicate the services we offer without overwhelming the recipients with too much information. - Brand Consistency: It's important that the postcard aligns with our company's branding, maintaining a cohesive visual identity. Ideal Skills and Experience: - Proven experience in creating high-quality and engaging marketing materials, p...
I need a professional to create a Figma software demo. The purpose of this demo is to showcase the key features and functionalities of our product clearly and engagingly. The is of "Y-combinator meets Kickstarter" You should research Y-combinator and Kickstarter if you are not familiar with them. Key Requirements: - The demo should be a high-level overvi...the demo should be concise yet comprehensive, with a good balance between depth and brevity. Ideal Skills and Experience: - Proficient in using Figma and creating engaging software demos. - Prior experience creating content for business audiences. - Understanding of software features and their value in a business context. - Excellent communication and presentation skills to ensure the content is clear and engaging for ...
...candidate should be able to deliver these classes in an in-person format. Key Training Areas: - Security and Risk Management - Asset Security - Security Architecture and Engineering I need someone who can provide thorough explanations and practical examples of these topics. Your role will be to break down complex concepts into understandable parts for the students. This means ensuring the content is clear, concise, and engaging. Ideal Skills and Experience: - Advanced CISSP certification - Experience in in-person training - Strong communication and presentation skills - Ability to simplify complex ideas - Understanding of adult learning principles Please only apply if you are an Advanced CISSP certified professional with experience in in-person training. Your ability to effe...
...Development: Proficiency in PHP and Python for server-side logic, data fetching, and processing. • Frontend Development: Expertise in JavaScript and modern frameworks for creating interactive and responsive user interfaces. • Database Management: Experience with MS SQL for querying and managing database operations. • Data Visualization: Ability to integrate and use visualization libraries to create clear and informative graphs and charts. • Export Functionality: Knowledge of libraries and tools to export data to PDF and Excel. • Authentication: Implement secure login functionality. • Previous Experience: Experience in developing dashboards, especially for POS systems or similar applications. Development Steps 1. Requirement Analysis o Detail...
...total property values and growth since purchase. - Total Debts: Calculate total debts for both home loans and non-home loans, including repayment amounts. - Loan-to-Value Ratio: Compute the ratio of property home loans to property values. - Available Equity: Determine available equity by subtracting total debts from total property values. *Summary Presentation:* - Present the results in a clear, concise, and visually appealing format, providing clients with a comprehensive understanding of their property portfolio and financial health. - Utilize charts, graphs, and tables to enhance visualization and facilitate easy comprehension. Attached are some screenshots of examples....
...for food. It's crucial for me to keep track of various aspects of my food-related transactions, including purchases, sales, and expenses. I require a professional who can translate these needs into a well-structured database. Key requirements include: - Data on food purchases, sales, and expenses should be efficiently stored and easily accessible - The database should be designed to facilitate clear accounting procedures - The system should be user-friendly and reliable, making it easy for me to input data and generate reports as needed Ideal skills and experience for this project are: - Proficient in database design, particularly for accounting purposes - Strong attention to detail to ensure accurate and comprehensive data tracking - Experience in developing user-friendl...
I need an expert to design an effective Business plan offering memorandum for my real estate business. The document will be targeted towards investors and aim to provide a clear understanding of our business model and financial health. Key Requirements - Business plan -Vacation rental industry not a must - Proven experience in drafting offering memorandums and business plans, preferably within the real estate sector. - Strong understanding of financial data presentation, particularly income statements, cash flow statements, and balance sheets. - Ability to design a document that is engaging and convincing to potential investors. The perfect candidate will demonstrate impeccable attention to detail, a solid understanding of the real estate and investment sector, and experience...