Goal seek vb punët

...make our workflow more efficient. Things I would l need from the right person: 1. An eye for details. A lot of our communication towards the end of completion on each site would be in regards to small fine elements of the sites as I want the quality control of our output to be high. 2. Ideally I would like to work with someone who has ideas of ways we can make the work even better but my main goal is to find someone at this stage who is simply capable of building something what the clients need. 3. I would want to work with someone who has a knowledge of seo and anything else that would enable to give our clients the best chance of their products and services being viewed and therefore used. 4. API integration. 5. An awesome human. I am working hard to move from a sin...

asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

...PDF, XML, JSON, and Text files in bulk and with the following additional features: - Bulk Signing: It should support signing multiple files at once, with no specific limit. - Predefined Output Path: Users should have the option to assign a default output path for the signed files. - PDF Signature Display: For PDF documents, the utility should display the signature as an optional feature. The goal is to have this utility developed within a month. Ideal skills for this project include: - Proficiency in programming languages suitable for file processing (e.g. Python, Java) - Experience in developing software utilities or tools - Familiarity with e-signing mechanisms and standards - Prior experience in working with PDF, XML, JSON, and Text files - Ability to create a user-frien...

Hello, we are looking for a person or a team to create websites for us. Creative, clear and modern designs should be created. Most of the Projects are company website like : main page incl. 4 subpages. The primary goal of this site is designs that are creative, clear, and modern, with a focus on incorporating animations. We have numerous projects every month. Key elements I'm looking for: - Proficiency in creating modern, visually appealing websites with clean design. - Strong expertise in UI/UX design principles to ensure an intuitive user experience. - Attention to detail and a commitment to delivering websites that are both visually striking and user-friendly. Skills and experience required: - Proven experience in designing and developing modern, professional websites - S...

I need an experienced full-stack WordPress developer for a quick project turnaround. The specific goal of this project is to develop a comprehensive and professional website for an IT organization. Essential Skills: - Strong expertise in WordPress - Experience in theme customization - Proficiency in developing custom functionalities - Solid understanding of fully responsive designs - Design, Development, and customization are essential skills Key Project Details: - Enhance the WordPress theme (Avada expert) - Develop unique functionalities based on project requirements - The website is expected to include: an 'About Us' page, a detailed 'Services' section, a diverse 'Portfolio', comprehensive 'Team' information, and compelling '...

I'm in need of an experienced PHP MySQL developer to handle data management and manipulation, database design and optimization, as well as web application development for my project. The goal is to create a robust e-commerce website with the following features: - Product listing and details - Payment gateway integration Ideal candidates should have a rich background in PHP MySQL, web application development, particularly in e-commerce platforms, and database design and optimization. Your skills in crafting systems that are user-friendly, secure, and streamlined will be essential. Emphasizing on data management and security is also paramount in this project. Let's connect if you possess these skills.

I'm in need of a skilled email cloud engineer. The primary goal of this project is to reconfigure my domain email to ensure that: - It can send emails to a wide range of email platforms such as Gmail, Yahoo Mail, Outlook, AOL, and others. - The emails sent are treated as high-priority emails and arrive in the recipient's inbox. I attached some sending errors I received to enable you to know what you're dealing with Key Requirements: - Ability to configure the domain email to send to all popular email platforms. - Ensuring fast delivery to the inbox. - Limiting the email sending rate to less than 20 per day. Ideal Skills and Experience: - Proven experience in email cloud engineering. - Strong understanding of different email platforms' requirements. - Familiari...

I need an experienced WordPress developer to work on specific page updates with Elementor and ensure they're completed by Monday morning. Key Requirements: - Implement design changes: The primary goal is to refresh the brand image, ensuring it's consistent with our current branding. - Efficient and quick: This is an urgent task, I need someone who can start today and complete it by Monday morning. Ideal Skills and Experience: - Proficient in WordPress: You should be well-versed in WordPress, particularly in working with Elementor. - Strong design sense: Experience with design and branding is crucial to ensure the updated pages align with our brand image. - Time management: The ability to work under tight deadlines and deliver high-quality results promptly is extremely im...

...Hindi/English languages. - Proven track record in translating spoken word for business or corporate settings. - Deep understanding of professional and cultural nuances in Japanese business contexts. Your responsibilities would include attending business meetings (in person or virtually), translating discussions as they unfold, and potentially engage in direct dialogues if clarification is needed. The end goal is to empower seamless communication between my team and our Japanese associates. Your expertise will be pivotal in ensuring nothing gets lost in translation. Having a background in business or economics will be a huge plus but it's not mandatory. This is a high-responsibility role so I am only considering candidates with substantial experience in this specific field...

Hello, I need a skilled website developer to create a site offering dual functionality of IFSC and Pincode lookup. The features required are: - Pincode lookup: Displaying detailed area information related to the entered Pincode. - IFSC lookup: Displaying bank details related to the ...lookup: Displaying bank details related to the entered IFSC code. This job is ideal for someone experienced in incorporating interactive lookup functions into website design. An understanding of banking data and geographical area details would also be advantageous. Please only apply if you can demonstrate prior, similar projects in your portfolio. Domain Name & Hosting is already available. The main goal is to monetize this site and generate good revenue through advertisements and other means. ...

Project Description: We seek a highly skilled software developer to compile the ARM64 code from GitHub, based on Golang 'go'. Your role is crucial in ensuring the Velociraptor server operates flawlessly on the Odroid N2+ platform (4GB RAM) by creating an installer or Debian package (.deb) that functions flawlessly on Debian Ubuntu 20.04 (MATE Desktop). The ARM64 code is available online, and we wish to have it as a package so the user can run it and go through the setup of the velociraptor server seamlessly on the N2+, use the local webserver to create agents (sensors as MSI or exes) and analyse/collect remote endpoints using the open source tool on the box. This project involves adapting the Velociraptor software, an open-source security tool , to work seamlessly

...roll out and manage a consistent email marketing campaign for my Product A. - Product: I'm focusing solely on the promotion of Product A through email marketing. - Target Audience: The campaign will be targeting individuals in the age range of 30 to 65. These consumers should fit the profile of the typical email user who is interested in purchasing products online. - Objectives: The primary goal of this campaign is to increase sales of Product A. However, I am also looking to use this campaign to build brand awareness and drive traffic to my website. The ideal candidate for this position should have a strong background in email marketing, especially in relation to e-commerce. They should have experience in: - Building and executing successful email marketing campai...

I'm looking for a skilled Flutter developer who can help me build a multi-platform application that is set to be a long-term project. My primary goal is to have a reliable app that includes a variety of features to provide a seamless user experience. the app which we building will be used 24/7/365 non stop always on Skills & Experience: - Proficiency in Flutter development across multiple platforms (Android & iOS , Windows , Web). - Strong understanding and experience with user authentication, push notifications, and local database management. - Prior work with Firebase authentication . - Experience in hardware and IoT integration . THIS IS A LONG TERM PROJECT IS NOT A ONE TIME THING AND IT MIGHT TAKE A YEAR TO FINISH PLEASE WRITE FOR ME WHY WOULD BE THE BEST F...

I need an experienced Amibroker AFL developer to convert an Andean oscillator into a personalized AFL code. - **Objective:** - Convert a specific technical indicator into an Amibroker AFL code. - **Customization Level:** - Medium customization is the goal, which will allow me to tweak parameters as necessary. - **Intended Use:** - This conversion is primarily for personal use. **Ideal Freelancer:** - Proficient in AFL and Amibroker platform. - Familiarity with technical indicators. - Able to work on medium customization levels. - Past experience with similar projects would be beneficial.

I am looking for a professional resume writer with a solid understanding of academia and its unique requirements. The main goal is to highlight my skills and qualifications for a specific role as a Software Developer, Marketing Manager or Project Coordinator. The perfect candidate for this project: - Has previous experience writing and improving resumes specifically tailored to academia - Understands the nuances of the academia roles I am targeting - Can highlight my skills and qualifications effectively, ensuring I stand out from the crowd Your task will be to refine and enhance my current resume to make it more appealing and suitable for these roles. Your process should involve a detailed review to identify areas of improvement, followed by comprehensive revisions and possibl...

I seek a talented designer to create a vintage-style logo and stylised font for my hospitality concept - Red's Australian BBQ The design should evoke a sense of nostalgia and charm, capturing the essence of a bygone era. Key requirements include: - A wordmark (brand name in a stylized font) that complements the vintage theme - A mascot or character that embodies the unique character of the concept Ideal candidates will have: - A strong portfolio showcasing experience in vintage or retro design - Proficiency in creating unique, eye-catching typography - The ability to create engaging mascot or character designs I look forward to your submissions.

Logo Design Brief for 'LinkLogic' Project Overview: Design a logo for a consulting business ‘LinkLogic’ that offers data strategy, business transformation and media management services. The logo should reflect the essence of the business, which focuses on data strategy for marketers. Objective: The main goal of this project is to create a new, memorable, and versatile logo. The logo should reflect the company's commitment to innovation, collaboration, connection, and technical excellence. It must be adaptable for use in various media formats, including print, digital, and social media platforms. The logo should also appeal to potential partners, investors, and industry professionals Target Audience: * Marketers * Agencies Brand Personality: * LinkLogic...

I have a report written by three individuals, each with a different style, saved in Microsoft Word. My goal is to transform it into one document that is coherent, maintaining a formal and technical tone, suitable for a corporate executive audience. Key responsibilities: - Analyze the multi-authored content for inconsistencies and style disparities - Consolidate the three styles into one uniformed, technical language - Enhance professional clarity, without losing any significant information Proficiency in Microsoft Word is necessary. Previous experience in technical writing and a keen eye for detailed analysis will be valuable for this project. Strong comprehension of formal business language is also needed to meet the project's requirements.

...via a chat interface. Key requirements for this project include: - Implementing an NLP AI model: You should have a solid understanding of NLP concepts and be able to integrate this into the website effectively. - Chat interface development: The chat interface should be user-friendly and engaging, allowing users to receive responses to their prompts seamlessly. - Basic customization: Although we seek a simplistic design, the chat interface should still maintain a professional and appealing look. This means including preset themes for customization. We have a model on google colab which uses GEMINIAI and answers based on the prompt. I need to integrate this into the website. The website will answer questions on "How to fix___?" by returning the tools required and the st...

The goal is to adjust timing of subtitles. The subtitles are in English. The video is in German. It is important that only the timing ist adjusted the content of the subtitles file must remain exactly the same. There is about 850 subtitle files that cover about 10 hours of video (each clip is about 40 seconds). The audio quality is excellent (studio quality).

...showcased through a combination of images and videos. - Content Creation: The freelancer will create and upload necessary fitness, health product and music animated videos. The goal of this content is to engage the TikTok audience and ultimately achieve 20 plus followers. You tube or viral tik tok video to be downloaded , recreated (legally with little tweet), 100 viral video, all recreation has to be approved /acceptable to TikTok, viral existing product TikTok video to be reproduced with animation AI, fitness related video to show case muscle graphic impact animation(could be done with AI) The primary goal of this project is to engage and grow the community around my TikTok account. Ideal Skills and Experience: - Experience with TikTok shops and product (100 produ...

I'm looking for a highly skilled developer to construct a well-integrated business portal for me, which includes website and apps for both Android and iOS. The portal should be able to efficientl...inventory management, order management, and supply chain management. - Financial and taxation modules. - Human resources and marketing modules. - Service and productivity modules. An ideal person for this job should have: - Proven experience in creating and managing business portals with similar components. - Proficiency in various programming languages for website and apps development. The goal is to create a unified system that will drive productivity, improve customer service, and increase overall business efficiency. If you have the right skills and experience, feel free to ...

I'm in need of a talented and experienced UX designer to create an end-to-end game specification for a captivating and uncomplicated game for mobile devices. - Target Audience: The game is designed to be accessible to all age groups, so it should have a universal appeal and be easy to understand and play. - Primary Goal: The game's core objective is to entertain the players. It should be engaging and provide a satisfying gaming experience. - Preferred Genre/Style: The game falls under the category of hand and mind coordination. This indicates that the game will challenge the player's ability to quickly and accurately coordinate their hands with their mental processes. Ideal skills and experience for this job include: - Proven track record of designing successful mo...

I'm in need of a seasoned web developer to create a modern, minimalist website for my business. The primary goal of this website is to encourage visitors to fill out a contact form. Ideal Skills and Experience: - Proficient in web development, with a strong portfolio of minimalist, professional websites. - Skilled in user experience (UX) and user interface (UI) design to create a visually appealing website. - Experience with creating effective contact forms and other lead generation features. - Good understanding of SEO best practices. Key Requirements: - Develop a clean, modern, and minimalist business website. - Implement a user-friendly contact form that encourages visitors to reach out. - Optimize the website for SEO to increase online visibility. If you're a develo...

I'm looking for a professional to create an instructional video on the installation and service of an in-wall concealed cistern. This video will serve as a guide for professional plumbers. Key Responsibilities: - Cr...and safety precautions involved. - Provide additional information on the service and maintenance aspects of the cistern. Ideal Skills and Experience: - Prior experience in creating similar instructional videos. - Thorough understanding of in-wall concealed cistern systems. - Strong communication and presentation skills. - Familiarity with the needs and expectations of professional plumbers. The goal of this project is to provide a valuable resource for professional plumbers, ensuring they can confidently and correctly install and service our in-wall concealed ...

I'm in need of a skilled developer who can help me build an interactive website targeted at professionals and businesses. The main features of the project will involve creating animations, implementing interactivity, and buildi...implement interactive elements. Ideal Candidates: - Prior experience in interactive website development. - A strong portfolio showcasing previous works that demonstrate skills in Canvas, GSAP, and three.js. - Understanding of user experience and how interactivity can enhance it. - Ability to cater to the needs of a professional and business-oriented audience. This is an exciting project with a clear goal. I need someone who not only has technical expertise in these tools but also has a creative mindset to develop engaging and interactive elements fo...

I'm looking for a skilled website designer to create a captivating website that will help me attract clients for my existing business set up services in Dubai. The website's key goal is to appeal to business persons who will be our primary target audience. Key Points: - The website must be visually appealing, user-friendly, and reflective of a high-end brand image. - It should have a clear focus on the unique offerings and services of my upcoming hospitality business. - The design should be optimized for conversion, encouraging business travelers to inquire or book with us. - Experience in designing websites for Dubai-based businesses would be a big plus. - You should have a good understanding of user experience design principles and SEO best practices, as well as an abi...

I am looking for a capable freelancer to develop a chemical reaction generation model. The goal is to do retrosynthesis, so basically predicting reactants from every SMILES product on my test data. You can use whatever you want(pre trained models or you own script)

I'm in need of a talented UI designer who can help me create a professional and effective landing page. My goal is to generate leads from professionals. Key Requirements: - Designing a user-friendly, visually appealing landing page that effectively targets professionals - Ensuring a clear, easy-to-use call-to-action for users to setup a meeting - Incorporating elements that encourage lead generation Ideally, you should have: - Proven experience in UI/UX design, particularly for lead generation purposes - Strong understanding of landing page best practices - Clear communication skills and ability to understand and implement client requirements. Looking forward to your bids.

I need someone who is proficient in data analysis, particularly with unstructured data sets. The primary goal of this project is to extract insights from both text and numerical data. You'll also be required to perform machine learning techniques such as LDA and NMF. Key Responsibilities: - Extracting insights from unstructured text and numerical data - Utilizing machine learning techniques like LDA, NMF, etc. - Ensuring an ethical approach to data analysis - Asking the right questions for analysis and providing detailed insights Requirements: - Extensive experience in data analysis, particularly with unstructured data - Proficiency in machine learning techniques like LDA and NMF - Strong ethical understanding and the ability to consider ethical implications in data analysis...

I'm seeking an email marketing specialist to assist me in creating a campaign that will reach potential customers and generate leads for my business. Key Requirements: - The primary goal of this campaign will be lead generation, so your experience and success in this area will be crucial. - You should have a strong background in creating and executing successful email marketing strategies, particularly focusing on promotional offers. - Familiarity with targeting potential new customers is essential as they are the main audience for this campaign. Your responsibilities will include: - Crafting engaging and effective emails that will capture the attention of potential new customers. - Implementing a lead generation strategy that encourages recipients to take action. - Monitori...

I'm in need of an AI-based image editing solution that can replace skies and chromakey functions for our web-based applications. Key Features: - The primary goal of this AI image editing solution is to automatically perform color correction, chromakey, and sky replacement on images. - The tool should be able to process a large number of images with speed and accuracy, enhancing the visual appeal of our content. Compatibility: - The solution needs to be compatible with web platforms, ensuring seamless integration and operation within our existing systems. Ideal Skills and Experience: - Strong proficiency in Python programming, particularly in the development of AI solutions. - Previous experience in image processing and editing, with an emphasis on color correction and chrom...

...the interior formatting and cover of the book. The book contains 137 pages and incorporates approximately 20 full-page images of migrant women in business. - Ensure that the pictures are integrated seamlessly within the book's content, enhancing the narrative and engaging the reader. - The design should be colorful and vibrant in nature to capture the reader's attention and support the book's key goal of raising awareness about migrant women in business. Ideal skills and experience: - Proven experience in book design and formatting, particularly for Amazon KDP. - A strong portfolio of work that demonstrates the ability to create engaging and vibrant designs. - The ability to integrate images effectively within a book's content. - An understanding of how to ...

Seeking a talented designer to bring my ideas to life and create stunning advertising posters for social media platforms. Key aspects of the project include: - I have some initial ideas for the poster, but I'm definitely open to creative and innovative suggestions. - The main goal of these posters is to advertise a product effectively on various social media platforms. The designs should be visually appealing and draw attention to the product's benefits. Ideal skills and experience for the job: - Proficiency in graphic design software - Creative flair, originality, and a strong visual sense - An understanding and experience with designing advertising materials for social media platforms - Ability to take direction and implement changes based on constructive feedbac...

I'm seeking an expert C# developer to create a powerful software for Windows that will cater to the needs of advanced-level programmers. Ke...including code editing, compilation, and debugging - The program must be user-friendly yet comprehensive to accommodate the intricate requirements of advanced users Skills and Experience: - Strong proficiency in C# programming is mandatory - Prior experience in designing and developing development tools is highly preferred - A solid understanding of Windows operating system is crucial The primary goal of this project is to deliver a highly functional, effective, and efficient tool for the advanced C# programmer. If you have a track record in creating successful development tools and are confident in your capabilities, I'd be gl...

...assembly language. Knowledgeable in gaming input emulation and keyboard input simulation. Experience in backend applications is beneficial. Project Specifics: The emulator must not breach game firewall securities or require unauthorized system modifications such as disabling driver signature enforcement. It should operate successfully in the game, similar to devices like Arduino Leonardo or ESP32. The goal is to simulate pressing the Z1 keys solely through software, without external devices. Activation should be tied to the Caps Lock LED status—active when on, and inactive when off. Solutions utilizing 'keybd_event' and 'SendInput' do not meet the requirements of this project; a deeper, more intrinsic approach is necessary. Conditions: The keyboard emu...

I'm seeking a proficient copywriter with a proven track record in creating persuasive, conversion-focused content. The primary goal of this project is to increase sales, particularly targeting young adults in the 18-34 age range. The key deliverable will be website content. - Proven Experience: An ideal candidate should have experience in copywriting, particularly for e-commerce or service-based websites. - Understanding of Young Adult Audience: Deep understanding of the preferences, pain points, and communication style of young adults is essential. - Sales-Oriented Approach: The content created should not just be engaging, but should be explicitly designed to drive sales. The success of this project will be measured by an increase in site conversions, so a background in moni...

* Must have atleast 1 year experience working with on-page/off-page optimization, link-building, directory submissions, blog/forum commenting, article submissions, back link strategy implementation and link wheeling. * Develop and execute SEO strategies to increase organic search rankings and traffic. * Perform keyword research a...various analytics tools, such as Google Analytics and Search Console. * Collaborate with cross-functional teams to implement SEO recommendations. * Be responsible for all regular (and ad hoc) reporting and analysis of digital activity providing crucial insights into further sales and marketing opportunities. Please share your relevant experience and strategies you plan to implement to achieve my goal of increasing website traffic Only Freelancer allowe...

I'm looking for a knowledgeable individual in the field of Mathematics, specifically Graph Theory, who can efficiently and accurately rewrite my research. The primary goal here is to create a fresh version with distinct wording while preserving the important findings and messages. The main section requiring your expertise is the Methodology. I expect a comprehension of mathematical concepts and a strong proficiency in interpreting and rewriting complex research methodologies in a clear, engaging manner. Key Skills & Experience: - Proficient in English - Mathematics, specifically Graph Theory - Exceptional writing and editing skills - Experience in research re-writing. - Solid understanding of research methodologies. Please only bid if you can demonstrate your capacity t...

I'm seeking a professional to help me with a personal E-commerce data analysis project. I have access to a range of data sources including E-commerce platform data, sales data, and payment data. The primary goal is to create a comprehensive report that delves into the sales and payment analysis of my E-commerce business. Key objectives for this project: - Identify sales trends: I'm looking to understand the various sales trends that have emerged from the data over the period of time it covers. - Analyze payment methods: I want to categorically understand how my customers are paying for their purchases, and if the payment methods are changing over time. - Discover customer preferences: The project also aims to uncover key customer preferences and behaviors. Your role will...

I'm seeking an experienced designer to clean up my Figma dashboard design, with a keen focus on layout and overall design cleanliness. The ultimate goal is to make it extremely easy for our frontend developer to implement the design using dev mode. Key Responsibilities: - clean up the design so it is easy to implement for the frontend developer - Setup simple prototype descriptions to make it easy to understand the features Ideal Candidate: - Proficient in Figma and dashboard design. - Experience with designing for developers' implementation. - Strong UX/UI skills to enhance user experience.

I'm seeking an expert in Excel who can help me with a few diverse tasks, such as data entry, creating formulas and functions, and conducting data analysis. The dataset I'll be working with is medium-sized, ranging from 100 to 1000 rows. The primary goal of this project is to organize and structure the data. Ideal skills for this project include: - Proficiency in Excel, including using formulas, functions, and pivot tables. - Excellent attention to detail for accurate data entry. - Experience with data analysis and the ability to draw meaningful insights from the data. - Strong organizational skills to structure the data effectively. Ultimately, I'm looking for someone who can help me streamline my data management processes and turn this data into comprehensible insi...

...SEO expert who can help me elevate my website on all fronts. The main goal is to not just increase traffic but to also improve my search engine rankings and ultimately, boost the conversion rate. Key Requirements: - **Boosting Website Traffic**: My current website traffic is insufficient and I need a substantial increase. The ideal candidate should have a proven track record of significantly increasing website visitors in a time-efficient manner. - **Enhancing Search Engine Rankings**: I want to rank higher on search engines. The freelancer should be proficient in SEO strategies and techniques, and be able to provide a plan for optimizing my website's ranking. - **Generating Leads and Conversions**: Ultimately, the goal is not just to increase traffic, but to convert...

...schedule. Functionally, most of our team has at least three hours of overlap with US Pacific business hours (09:30 - 19:30 in UTC -07:00) Monday - Friday. 2. Fully Flexible Schedule: Work 40 hours per week, with the freedom to adjust your hours as needed. Take up to two days off per week, tailored to your preferences. 3. Paid Overtime: Earn extra pay for any hours worked beyond 40 per week. 4. Team Goal Bonuses: Benefit from group bonuses when we achieve company goals. 5. Virtual Assistant Retreat: Enjoy all-expenses-paid gatherings to meet and connect with colleagues when our team grows. 6. Flexible Vacation: Take time off when you need it, just inform us in advance. 7. Paid Holidays: Enjoy ten paid time-offs for recognized US, PH & IN public holidays. Simply notify the team...

I need a proficient data operator to help manage our customer and product data. The primary goal of this project is to improve our customer experience. Key responsibilities include: - Handling and organizing customer and product data from multiple sources - Ensuring data accuracy and integrity - Implementing strategies to improve customer experience based on data insights The ideal candidate should have: - Previous experience in managing customer and product data - Strong analytical skills and attention to detail - A good understanding of customer experience and how data management can contribute to its improvement.

I need an online(not mine) website converted into a WordPress site. The site has a clean, modern design and I would like to retain this when it is migrated. Key requirements: - Preserve the design layout and content structure - Ensure that the website's navigation is intuitive and user-friendly - Install a contact form plugin to allow visitors to get in touch easily The primary goal of my website is to inform and educate visitors. Therefore, it's crucial that the new WordPress site is easy to update and manage so that I can continue to provide fresh, engaging content. Ideal skills and experience: - Proven experience in WordPress development - Strong understanding of web design and user interface principles - Ability to preserve and improve upon the existing design and ...

My goal is to increase sales of my fiction books primarily targeted towards children and young adults. I'm seeking a seasoned and socially savvy book influencer to generate interest and drive sales via engaging online content. Key Objectives: - Create buzz around my book collection - Increase book purchases - Engage with young readers and literature enthusiasts Ideal Collaborator: - Should have established relationships with book publishers and authors - Has previous experience in effectively promoting books to young readers. - Proven track record in the literature influencer industry - Demonstrates exceptional communication skills. Together, our mission is to instill a love of reading in our targeted audience and subsequently, increase book sales. I look forward to pa...

I'm in need of an Excel expert who is well-versed in Excel and has experience in creating detailed and visually appealing dashboards for project management purposes. The primary goal of this dashboard is to help me track the effort and progress of my project. The information that I'd like to track includes: - Time spent on tasks - Percentage of completion - Deliverable status The excel is small and has only 15 rows its more like visualization task so that all data can be projected in one place as a dashboard.

I am looking for an expert in Google organic SEO to improve the ranking of my website's home page and contact us pages. The main goal is to increase my website's traffic. Here's what I expect from potential freelancers: 1. EXPERIENCE: Proven experience in SEO and a comprehensive understanding of Google's ranking algorithm. 2. STRATEGY: A clear, well-defined strategy for improving the ranking of my website's home page and 'Contact Us' page. 3. BUDGET: In your application, please include a detailed project proposal with a competitive price. With your expertise, I hope to improve my website's visibility and drive more traffic. Please provide examples of past work that demonstrate your capabilities in this area. Only those who can ...