Vb job punët
Vhbhtfjuffugrcv o8tdjdegkds kdjbbsc yfyskdhh ikbofbkfgjo
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
work now! Please mention if you worked on version 3 or 4 :) Need opencart for minor customs works, please only opencart people. !!!!!!!!!!!!!!!!!!!!!!!!!!!
Please mention if you worked on version 3 or 4 :) Need opencart for minor customs works, please only opencart people. !!!!!!!!!!!!!!!!!!!!!!!!!!!
$13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me
$13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me $13.00 /jam job for me
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
gdgkiuukgklgkjdgkgdhgghsgjkhfejfghjksdbjidshbkfjlndjhkjdnfkjdghuifnbjklfhdisjnfjdhfihjhejhkdlnfjdnfljkrhfiujnlknduiherionfgioehfienmihsdlkfmdkfukdmkduyfkdntdghifjhrjgbiodghjkfnfgjidhjifnrjkovhdjignjrkhfijrngjrghjrbguierygfiu5ntguiryfiorngurehgoirghurehngjkrhguiorhntiorhg8rntgjkfhguoitngijigmtighujtihgmtigujrijtgsopjdfigkjfiogbujtrikgjfiobvjhkrgjmndiohgkrmngkofjhgkotmngkjlfyotjrngjmdgifuhbdkjfhgdgjkdfhjkdhfjshgjerhyuiotyheruyhudjnmd,nvuidfy984yhoen huifyhry9erhfjhdughrgtnr hyeouifyhr tyry rguy ru grtiorhfgir ng r tr u9r fr f9ryurohfdghdfkjhffdjhrwhiorhrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr hrjlklllllllllllqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee...
Ebay job jjajajsjsjsjsjisksjiisjsjsnnsnznzjzjjsnzjznsnsjnsmsnjsjs no
We are seeking an experienced [VA] to help us with our company tasks such as social media posts, research data entry etc... The ideal candidate should have a strong background in [LinkedIn Job posting - data entry - Google drive/sheets] The tasks are very simple, however, this will be ongoing, daily work for the foreseeable future. Must be reliable and consistent in order to be successful in this role
...understanding of MySQL and APIs • Project Objectives: 1. Job Search Functionality: Incorporate an effective search feature powered by job title or keyword, location, and industry or department filters. 2. Resume Submission and Storage: Establishment of a user-friendly interface that allows effortless resume submission and secure storage. 3. Application Tracking System: Implementation of a reliable tracking system to manage and monitor application statuses. The module should sport a clean and minimalist design, emphasizing utility and user engagement. The ideal freelancer would have previous experience with platform and job module implementation. I have enclosed the detailed requirement in the document. Let's craft a streamlined job-search e...
...User Registration and Login: Secure, straightforward registration and login process for both employers and job seekers. - Job Posting and Search: Employers should have the ability to post their job offerings easily with all the necessary details. Likewise, job seekers should be able to search for jobs based on various criteria. - Payment Processing: A secure payment processing system integrated into the website to facilitate any required transactions. The site must be designed in a modern style to reflect the contemporary aspect of the service. Skills / Experience: - Proven experience in web development, particularly in creating job posting websites. - Proficiency in user registration, job posting/search, and payment processing functionalitie...
Hi, I am looking for a person to do a data entry job. I will provide a group of 80 files. The job comprises of 3 tasks : For each file: 1. Replace the logo 2. Replace text 3. Create prompt for the text, copy paste from chatgpt Finish!
so as per discussion, you want to make 2 template design change, i will make it same like you gave
I'm looking for a professional copywriter with a strong understanding of technical, sales, and IT roles to help me create detailed and engaging job descriptions. Key Responsibilities: - Craft full comprehensive job descriptions for each role, incorporating both bullet points and paragraphs to provide a comprehensive view of the responsibilities and requirements. - Ensure the descriptions are tailored to the specific roles, highlighting the unique aspects of each. - The ability to infuse the descriptions with a persuasive tone that can attract the right candidates. Ideal Skills and Experience: - Previous experience in writing job descriptions, especially for technical, sales, and IT roles. - An understanding of the different requirements and terminologies assoc...
Seeking a seasoned professional to guide me through landing entry-level data analyst roles or paid internships, all remotely. Responsibilities include job search, application assistance, interview coaching, and negotiation support. Offering 20% of my monthly salary as compensation upon successful placement. If you're skilled in career coaching and passionate about helping others succeed, let's collaborate!
We, a small family-run driving school from Germany, are looking for a new employee for our office. In order to spread the word about the job, we are looking for a poster design and a document for our social media pages. It should be simple in design and include our company logo, but the text must be prominent and legible. Maybe you could also use one or two of our pictures in the attachment. The headline of the ad reads: "Bürokraft (m/w/d) gesucht" The main text is: "Wir, die LOGO Fahrschule Kraus, suchen zum 1. Juli eine neue Mitarbeiterin oder einen neuen Mitarbeiter zur Unterstützung in Verwaltungsaufgaben und den Bürotätigkeiten, sowie der Gestaltung unseres Social-Media-Auftritts und Marketing-Maßnahmen. Die Stelle umfasst zunächs...
I am currently looking for a part-time position in the technology industry. The ideal role for me would be at a mid-level skill requirement. Key Details: - I'm seeking part-time work - My focus is on the technology industry - I'm looking for a role that requires a mid-level of skills Please consider my profile for any such opportunities.
...skilled Flutter developer to build a job portal app compatible with both iOS and Android devices. The main features to include in the design are: - Job seeker functionality: Browsing listed profile, Listing own profile, attaching a resume, add manually typed resume, building resume, etc - Employer functionality: High-level filtering candidate profiles, Viewing candidate profiles, scheduling an interview with them, should able to take a report for day/month/year, etc for how many were interviewed, selected, completed what stage, add team members for the interview panel, review a candidate, favorite profiles Experience in cross-platform app development, especially in Flutter, is of high importance. As we aim to provide a streamlined user experience for job seeker...
We are looking for a remote support specialist to help with daily job postings on LinkedIn. Requirements: - Making one job post per day - The job post should include all the necessary information such as job title, description, requirements, and qualifications which we will provide this for you. Ideal candidate: - Excellent written communication skills - Proficient in using LinkedIn for job postings - Ability to follow instructions carefully This role is simple and only takes few mins per day, we welcome everyone to apply especially those who are starting out as freelancers on this platform.
I'm looking for a professional copywriter with a strong understanding of technical, sales, and IT roles to help me create detailed and engaging job descriptions. Key Responsibilities: - Craft full comprehensive job descriptions for each role, incorporating both bullet points and paragraphs to provide a comprehensive view of the responsibilities and requirements. - Ensure the descriptions are tailored to the specific roles, highlighting the unique aspects of each. - The ability to infuse the descriptions with a persuasive tone that can attract the right candidates. Ideal Skills and Experience: - Previous experience in writing job descriptions, especially for technical, sales, and IT roles. - An understanding of the different requirements and terminologies assoc...
We are seeking a proactive and dedicated Full-Time Customer Service/Project Manager to join our team and be a part of our start-up Home Services Business. You'll be the go-to person for our clients and the mastermind behind project management. This role requires flexibility, as you'll be working in US hours - EST (3pm SAST – 11pm SAST). Interested? Role Responsibilities: • Customer Support Specialist: Resolving Issues & Ensuring Satisfaction • Operational Efficiency Guru: Providing Tech Solutions & Support • HR Support Champion: Recruiting, Training, and Coaching Staff • Service Team Leader: Setting Expectations & Performance Reviews • Financial Wizard: Budgeting and Forecasting for Success • Service Enhancement Expert: Improving ...
I'm searching for a freelancer to help me apply for business-to-business (B2B) sales roles within the technology sector, in Barcelona, Spain. With my detailed CV and presentation letter as starting points, I'm aiming for applications that will make a strong impact. I trust you to use your expertise in job applications to highlight the capabilities most sought after in B2B sales roles. Success in this project would hinge on your knowledge of the technology sector and understanding of sales roles. Ideal skills and experience: - Familiarity with B2B Sales roles
I'm in need of a professional translator for a full-time role. The ideal candidate will be translating various documents from English to a specified language. Skills and experience: - Proven translation experience - Excellent command of English and the language we will be translating into - Ability to meet deadlines and work in a high-paced environment - Degree in translation studies is a plus. Please include examples of your work in your application.
I'm searching for a professional to create an impeccable CV for my job applications in the technology industry. The CV should be highly tailored to showcase my skills and experience in a way that appeals to potential employers. Key Deliverables: - Craft a CV in both PDF and Word formats. - Prioritize the content and layout to suit job applications. - Focus on my experience, skills, and achievements in the technology sector. - Implement a design that is both professional and visually appealing. Ideal Freelancer: - Proven experience in CV writing, particularly for technology-based roles. - Strong understanding of the tech industry and its job application requirements. - Skilled in both graphic design and content creation. - Attention to detail, ensuring no spelli...
I am looking for a person who can help me in applying jobs online, specifically on LinkedIn and other online platforms. If you have some understanding in online job application processes and can help with applying jobs based on resume/profile. I will provide the resume and logins for the profile.
I am currently in need of a graphic designer specialized in business logo design. This is a freelance job which allows flexibility in working hours. The ideal candidate should be creative and experienced in logo design that effectively communicates the identity of the business. This job allows remote work, therefore effective communication skills are necessary.
I am in search of an experienced full stack development team to create a job board. Both PHP and MySQL, as well as Ruby on Rails should be familiar technologies for the successful candidate/team. The features I require include: - Job search engine - Resume submission capability - Creation of employer profiles Equally important to functionality is design. The job board must have a modern, sleek aesthetic while remaining user-friendly and intuitive. Moreover, the platform should be customizable and flexible to accommodate future expansion or changes. A successful history in similar projects is highly desired for this task. Proven design skills and a keen eye for UI/UX will also be highly advantageous. Note: Read the attached document for more details
We are seeking an experienced [VA] to help us with our company tasks such as social media posts, research data entry etc... The ideal candidate should have a strong background in [LinkedIn Job posting - data entry - Google drive/sheets] The tasks are very simple, however, this will be ongoing, daily work for the foreseeable future. Must be reliable and consistent in order to be successful in this role
This should be a very simple job for someone with the correct knowledge. I have a temporary email website (and webflow app) where users can create temporary email aliases. These emails should automatically delete after 14 days but they are not deleting. I need someone to create a Cron Job on my shared hosting in cPanel. The task at hand is for an automatic email deletion sequence which deletes all emails older than 14 days in my cPanel email account and sends a confirmation email each time it runs to a specified email. Key Details: - There is already a cron job created but it does not work. - Specifically designed for cPanel email account and not other email service providers. - Test the functionality to ensure correct execution. - The cron job should not del...
I'm in need of a resume builder that can cater to my specific job application needs. The software should be able to generate a professional resume that can be customized according to the job I'm applying for. Key Features: - Customization: The software should allow me to create a resume from scratch. - Download: It should enable me to download the resume in multiple formats. Skills and experience required: - Proficiency in resume building software development. - Understanding of job market and requirements. - Experience in user-friendly UI/UX design.
I'm looking for someone with a LinkedIn account who can make 10 free job posts per month to LinkedIn on my behalf and respond to applicants. This takes me about 10 minutes per post. So 1.5 hours work per month. Once every 3 days, you will make a post (copy/paste mine), respond to applicants close the job post a new one. If you read all this include 88730 in your reply. Be aware, if you bid a price I will not accept any negotiation on that price if I reach out to you. Bid carefully. You do not need to write the posts; I have everything prepared for you. Once you send a single message to the applicants you never need to message them again. I have a whole lot of people already doing this on a regular basis, so you'll be joining a team. Not that you have to interac...
I'm looking for someone with a LinkedIn account who can make 10 free job posts per month to LinkedIn on my behalf and respond to applicants. This takes me about 10 minutes per post. So 1.5 hours work per month. Once every 3 days, you will make a post (copy/paste mine), respond to applicants close the job post a new one. I need you to prove you can do this by making a post on LinkedIn for our company first. We don't benefit from this -- but it does prove that you account is not blocked from doing it as some nations are blocked by LinkedIn unless they verify with credit card. If you read all this include 88730 in your reply. Be aware, if you bid a price I will not accept any negotiation on that price if I reach out to you. Bid carefully. You do not need to write...
I'm looking for someone with a LinkedIn account who can make 10 free job posts per month to LinkedIn on my behalf and respond to applicants. This takes me about 10 minutes per post. So 1.5 hours work per month. Once every 3 days, you will make a post (copy/paste mine), respond to applicants close the job post a new one. If you read all this include 88730 in your reply. Be aware, if you bid a price I will not accept any negotiation on that price if I reach out to you. Bid carefully. You do not need to write the posts; I have everything prepared for you. Once you send a single message to the applicants you never need to message them again. I have a whole lot of people already doing this on a regular basis, so you'll be joining a team. Not that you have to interac...
vb 2012 video and sound recorder. Auto record to file when motion/sound is detected. Auto save file if no motion/sound is detected for 5 seconds. exe File must be compact and small and not dependent on other dll or ocx. Auto detect existing cam and video device on PC. I should be able to compile it on my PC. Note there are a lot of samples on Chat GTP.
I will do data cleanup and cron job management for u.
vb 2012 video and sound recorder. Auto record to file when motion/sound is detected. Auto save file if no motion/sound detected for 5 seconds. exe File must be compact and small and not dependent on other dll or ocx. Auto detect existing cam and video device on PC. Note there are a lot of samples on Chat GTP.
Hi, I am looking for a person to do a data entry job. I will provide a group of 80 files. The job comprises of 3 tasks : For each file: 1. Replace the logo 2. Replace text 3. Create prompt for the text, copy paste from chatgpt Finish!
i need a Professional Resume to apply for a job after my Master's degree. it should be formal in style which includes all my education, work experience, and skills , to be highlighted in a way that attracts the employer's eye.
Job Description: We are looking for a talented freelance pitch deck writer to craft a compelling presentation that showcases our specialized telecommunications and cabling services for buildings. This pitch deck is crucial for communicating our unique value proposition and addressing the specific pain points of building managers. Responsibilities: -Create a detailed and visually engaging pitch deck that clearly presents our cabling services within buildings. -Integrate our existing logo and color branding to maintain visual consistency and brand identity. -Develop content that speaks directly to the common pain points of building managers, illustrating how our services offer effective solutions. -Design slides that are bold, colorful, and concise, with a focus on visual storytelli...
I'm looking for a simple online job that can help me earn extra income. I have less than 10 hours to dedicate to this job a week. Ideal skills: - Proficiency in any online job, such as data entry, virtual assistance, content writing, social media management, etc. - Ability to deliver results within a limited time frame - Good communication skills This might be a good opportunity for someone looking for a side job or extra cash without a huge time commitment. Please propose your specific job and how it can help me achieve my goal.
We need an online Virtual assistant to help us with our company tasks such as social media posts, research data entry etc... The tasks are very simple, however, this will be ongoing, daily work for the foreseeable future. Must be reliable and consistent in order to be successful in this role.
We are seeking a remote administrative professional to daily post job listings on LinkedIn. Key Responsibilities: - Daily job posting on LinkedIn, One job post per day. - Ensuring all necessary details and requirements are included Ideal Skills: - Strong administrative background - Excellent written communication skills - Detail-oriented with a focus on consistency This Task is easy and simple only takes few mins per day, also good for those who are starting out as freelancers and want to build their profile. We will provide all the necessary steps to follow so anyone can apply.
This is a fast and small job. I need hands, otherwise I can do it myself. It is like 1-2 hours work only(please read my profile before you bid). I am in need of a skilled Wordpress developer to convert my current HTML website to Wordpress. I would like to maintain the same look and keyword details of the current site during the transition. The project will not be considered complete unless the website aesthetics and keyword details mirror the original. In addition, I want a blog section added to this website. The site is VERY small and is more a information pillar for th company. I will be providing all the necessary content for the blog, so no content creation is required. Ideal skills and experience: - Comprehensive Wordpress knowledge - Experience in HTML to Wordpress conv...
I just need assistant to help me create some pages of my website using the reference website.. the website is already create now you need to use chatgpt to rewrite some pages and move them to my website. i will be online working with you. (this is a job for a assistant, junior wordpress).
I'm looking for a seasoned web developer to create a user-friendly recruitment website tailored to the needs of recruiters. Main functionalities include but aren't limited to: - **Job Posting**: Recruiters should be able to post job openings efficiently on the site. - **Input Information**: When posting, details like the job description, required qualifications, and job location should be clearly outlined. Ideal candidates will have prior experience in creating recruitment platforms and a deep understanding of recruiters' needs and usability preferences. Clear communication skills and a keen eye for detail will be highly appreciated.
i need the wordpress website expert for multiple jobs. Details will be discussed.
Full stack developer needed to join our dynamic team. Responsibility: - Strong knowledge in backend and frontend : React, Angular, Vue, TailwindCSS, Web3, Java, ASP.NET, Django, Flask, Restful API, - Good Communication - Work at EST Time - English Proficiency - Pakistan Developer Only If you are interested in this position, please schedule an interview.
I'm looking to create a marketplace website where both job posters and tradesmen can connect. The main features I'm looking for include: - **Job Posting**: A system where users can post jobs that need to be done. - **Connecting with Tradesmen**: A way for these job posters to connect with suitable tradesmen for their projects. - **Quoting System**: I need a system that allows tradesmen to provide quotes for the jobs. - **Tradesmen Sign-Up Page**: A simple, user-friendly page where tradesmen can sign up and create their profiles. The ideal freelancer for this project should have experience in developing marketplace websites, particularly those focused on services. Knowledge in user experience design, clean and modern UI design is also crucial. In term...