Vb program copy files progress bar punët
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
pershendetje mund te me ndimoni se si te punoj me kete program freelancer se nuk di ta perdor,,,,,ju faleminderit nese mundesh me kthe pergjigje
pershendetje mund te me ndimoni se si te punoj me kete program freelancer se nuk di ta perdor,,,,,ju faleminderit nese mundesh me kthe pergjigje
PLEASE CONTACT ME TO DISCUSS FURTHER
PLEASE CONTACT ME TO DISCUSS FURTHER
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
Detailed overall drawings will be provided ① Production of frame model - Basement of the first basement floor and first floor above ground, designated expression - Expression of floor level difference between the 2nd and 6th floors above ground - Expression of external f...detailed reinforcement model - Column, girder, beam (at least 1, reinforcement spacing doubled) - Foundation, slab (only partial representation) ③ RC beam bending, shear analysis and design ④ Preparation of detailed labor distribution model (planned) schedule ⑤ Detailed reinforcement model (planned) construction cost estimation - Quantity calculation basis, work type statement, tally table, bar chart - Scheduled for final presentation - actual comparison ⑥ Preparation of final presentation material (PP...
I need an expert in Arduino programming to develop a code that connects to an OV7670 camera, recognizes specific patterns (like a person's head) and triggers an LED. Key Requirements: - Use an Arduino Uno or Nano to interface with an OV7670 camera and LED. - The code should have a pattern recognition feature - specifically, recognizing a person's head. - When the pattern is det...camera's view. - This is an intermediate level project, hence the recognition should be accurate enough to detect the specific object. Ideal Skills: - Proficiency in Arduino programming and interfacing with cameras. - Experience in pattern recognition, particularly with an OV7670 camera. - Strong expertise in developing responsive codes on Arduino. - Ability to work efficiently and communicate ...
I am seeking a professional CSS developer with a strong understanding of responsive design and basic SEO principles. I have a specific audience in mind and a concrete branding guideline to follow, which will be disclosed to the chosen freelancer. Ideal Skills and Experience: - Extensive experience in CSS. - Proficiency in responsive design. - Basic knowledge of SEO. - Experience...using custom CSS. - Ensure the design is responsive on various devices. - Apply proper CSS animations. - Compliance with provided branding and color guidelines. - Employ basic SEO principles during the coding process. I am looking forward to a professional who takes deadlines seriously and delivers quality work. Communication is key, therefore I expect the freelancer to keep me updated of the progress ...
I require a freelancer who has exceptional skills in word processing and an eye for detail. Your task is to accurately transfer content from a digital PDF file into a Word file. Specific points for the job...skills in word processing and an eye for detail. Your task is to accurately transfer content from a digital PDF file into a Word file. Specific points for the job include: - The PDF contains both images and tables. These need to be included in the Word document. - Consistency is key - the Word document must mirror the formatting of the original PDF file as closely as possible. - This is not a basic copy-paste job. Your experience in this type of work, especially handling images and tables, is essential. Please apply if you are meticulous, reliable and have excellent skills i...
I'm aiming to build an enhanced e-learning platform that integrates artificial intelligence at its core. My vision is focused on three special features: Gamification, interactive quizzes, and progress tracking capabilities. This would effectively make learning fun, engaging, and easily monitored. The core functionalities I require include virtual tutors, natural language processing for student-teacher interaction, sophisticated robotics, and an advanced learning process. All these aspects and more should contribute towards fostering optimal communication and facilitating superior understanding and learning. I'm at the helm of an exciting Artificial Intelligence technology startup, and we're keen to grab a visionary investor who's aware of the AI landscape. Our p...
I am looking for some native English and Hindi typing experts. The project involves copy typing and data entry from PDF to Word files. I need only native Hindi speaker who is also fluent English speaker. You have to do typing manually and accurately. I have hundreds of pages. I need high-quality and accurate services.
I need my Google document converted into a word file for unspecified reasons. While the main purpose of the conversion was not stated, it could possibly be for editing, formatting, sharing with others, or printing as a hard copy. Therefore, the successful freelancer should ideally be experienced in handling such tasks and be ready to preserve any formatting elements present in the Google document. Please include in your application any past work related to this project or a detailed project proposal showcasing your approach towards this task. Note that the conversion must preserve fonts and styles, headers and footers, and bulleted and numbered lists.
Title: Adjust program to upload and save attachments Description: I created a program that uses HTML, CSS, and Javascript to enable patients to fill out their information, including the option to attach files. Upon submission, a PHP script is triggered to email the data to me as a CSV file. The attachments (typically JPEG’s or PDF’s) uploaded by the patients are not being included in the email. Objective: Adjust program to upload and transmit attachments with .csv Deliverables: - Updated program with ability to transmit attachments in csv - Documentation of all changes with code (unrestricted) - Format attachments as: o Insurance-patient’s last name-patient’s first name o ID- patient’s last name-patient’s first na...
Need of a skilled Google Ad expert to help with my Google ads. Build a online shopping site with small electronics parts retailing, ran the Google ADs for a few months from beginning(daily spending is around $10 because it's new site) however after running for a few months, the AD was suspended due to Circumventing systems policy as per Google informaton. Each time emailed Google but w...display ads. Skills and Experience: - Proven experience in successfully reinstating suspended Google Ad accounts. - Strong understanding of Google Ad policies and system circumvention. - Proficiency in both Search and Display ads campaign management and optimization. - Excellent analytical skills to identify and rectify issues. - Strong communication and reporting skills to keep me updated on the ...
I am looking for professional css, html, and js developer who is familiar with django. Mostly interested in CSS. Knowlaage of SEO is required. I need to make my website look professional and add a few things to it such as map and others...look professional and add a few things to it such as map and others. I will give you my intial design and you need to work on it on your own. Intial design means htmls, css only but I will not provide any backend code. After you get done with the design you will remote into my machine and plug everything in so I can test it. Important: My remote computer is monitored from the server, any try to copy any code will be immediately blocked. Sorry I am trying to protect my work. If you have the skills and willing to work with me please submit a f...
...debit authorization form (so the merchants don't have to key in the details again) such as merchant name, bank name, bank number, etc. 2) Pull information from Curlec once direct debit authorization is completed to be updated into my Zoho CRM In addition to that, I would like to be able to create a webpage/landing page with a unique URL to each merchant so they can self access to see what is the progress of their application without having to call FoodPanda's hotline. I know Zoho CRM has a portal functionality for this but I can't seem to make it work. For details of the workflow, can review this: https://docs.google.com/document/d/1Vd9TBeinhkh0D1Hzr1bxqqwlJhghTFqruGbVJ2KEfaw/edit#heading=h.4f6wj1qw8l7z and this
I'm in need of a talented Vue.js developer with a strong footing in frontend development. Your primary role will be to assist in building a fresh web application from the...requirements and vision - Develop the front-end of the web application using Vue.js - Implement responsive, pixel-perfect UI components Skills and Experience: - Proven experience with Vue.js in a frontend development capacity - Strong knowledge of Bootstrap for crafting responsive user interfaces - A good eye for design and attention to detail - Ability to collaborate effectively and communicate progress regularly. If you have experience with Vuex, Vuetify, or , it's a bonus, but not essential. The most important thing is a strong foundation in Vue.js and frontend development. Looking forward to work...
I am actively recruiting individuals and firms who use AWS for a partnership aiming at promoting the increased adoption of AWS through the CRP Program 2024. As a partner, you get to earn by launching projects on AWS. Projects that are core to this campaign include: - Web applications - Mobile applications - Data analytics solutions - Other AWS compatible projects Even though the ideal freelancer wasn't explicit, a solid background in AWS-based project launches will be a significant plus - conveyed by sharing past work, experience, and a detailed project proposal that reveals an understanding of what the initiative entails. No specific AWS services were pointed out as essential. However, having familiarity with EC2, S3, Lambda, among others, might be critical to more effectiv...
I'm in need of an experienced SEO specialist to enhance the online presence of my 4 accounting websites. My main goal is to increase the traffic to these websites. Key Responsibilities: - Conduct a comprehensive keyword research: Identify the most relevant and high-traffic keywords for the accounting industry. - Implement effect...implemented SEO strategies and make necessary adjustments. Ideal Skills and Experience: - Proven experience in SEO for accounting and financial websites. - Extensive knowledge of keyword research tools and SEO optimization techniques. - Strong analytical and problem-solving skills to interpret data and make informed decisions. - Excellent communication skills to provide regular updates on the project's progress. The project needs to be compl...
I'm looking for a talented graphic designer who can create live animations for screens in my bar. Specifically, I need animations of our logos, designed in a retro or vintage style. These animations will be used as permanent decor in the bar, so they should have an enduring appeal and add to the overall ambiance. Key Responsibilities: - Design and animate our logos in a retro or vintage style - Create engaging, eye-catching, and visually appealing animations - Ensure the animations are suitable for a bar setting and can be displayed continuously Ideal Skills: - Proficiency in graphic design tools and animation software - Strong understanding of retro and vintage design aesthetics - Experience in creating animations for commercial or public spaces - Ability to cr...
I have an ongoing project requiring a skilled Social Media Marketer who specializes in Instagram. The ideal candidate has a demonstrated history of succe...requiring a skilled Social Media Marketer who specializes in Instagram. The ideal candidate has a demonstrated history of successfully increasing an Instagram following, particularly among young adults. Duties and Responsibilities: - Implement creative strategies to grow my Instagram following and engagement. - Understand and cater to young adult interests, trends, and content preferences. - Regular progress reporting including engagement metrics and follower growth. Desired Skills: - Proven experience in Instagram marketing. - Excellent understanding of young adult market. - Ability to create engaging content appealing to you...
I am looking for an experienced content writer to craft a company profile that promotes my company's products/services. This profile should have a professional tone, and it needs to capture the essence of our brand. Key information should be compellingly delivered to engage potenti...of the company: Impart a reliable and customer-focused company image, detailing our journey, mission, visions, and values. - Detailed product/service information: Provide comprehensive and persuasive information about our products/services. -Inclusion of past work deck Ideal candidates will have previous experience writing professional company profiles and a knack for marketing and advertising copy. A strong understanding of brand development is also appreciated alongside excellent written commun...
For my ongoing project, I am in need of an expert in econometric analysis with a special focus on time series data. Here, the tasks will involve: Analysing short and long term relationships between variables. It can be Johansen cointegration analysis, ARDL or ARIMA analysis. Dependent variable; Bitcoin price movement The independent variables are the US interest rate, US inflation, and the NASDAQ index. This project would be ideal for someone who has a strong background in econometrics, statistics, and mathematics. Practical experience in using time series analysis techniques, particularly ARIMA, VAR, and ARDL is essential. Additionally, the ability to clearly communicate complex analysis results would be a significant advantage. Please bid with relevant experience and portfolio example...
I'm looking for a skilled WordPress developer to help me remove the "Powered by Woo" tag from my Analee theme. Unfortunately, I don't have direct access to the theme's files, so I need assistance with this task. Key requirements: - Familiarity with WordPress and theme customization - Ability to access and modify the theme's source code - Strong understanding of PHP, HTML, and CSS - Experience with removing brand credits on themes Communication will primarily take place via email, where I'll provide feedback and updates on the progress. I'm looking for someone who can deliver this customization promptly and efficiently. Please share your relevant experience when applying to this project.
I'm urgently in need of a Python specialist to accomplish an assignment using Jupyter Notebook. The task involves reading and merging multiple Excel sheets, and subsequently creating visual representations for the collated data. Key requirements are: - Deep knowledge of Python for data analysis - Proficiency in creating Bar Charts, Scatter Plots, and Line Graphs. - Strong skills in Excel data manipulation. Required libraries/packages expertise: - Matplotlib - Seaborn - pandas Your responsibility will be to decode the problems presented, manipulate provided Excel data accordingly, and present the output in an understandable visual format. Previous experience in similar tasks will be highly regarded. Will show the work on zoom and will connect and probably do it together Ma...
I'm in search of an SEO professional who can generate natural editorial backlinks to boost my search engine rankings. The specifics are: • Backlink Strategy: Build only natural editorial links. Spammed or self-created non-editorial ones are absolutely not acceptable. • Purpose of Backlink: The main objective is to improve my website's search engine rankings. • Niche Targeting: ...determine the most suitable niche for my backlinks. Skills and Experience Required: • Proven track record in effectively building high-quality, natural editorial backlinks. • Solid understanding of SEO, specifically in relation to backlink strategies. • Capable of identifying and targeting useful niches for backlink creation. • Excellent communication and reporting sk...
Signature Assignment: Construct Final Program Plan Proposal Title of the Program: Mental Health Awareness Among African Women Needs Assessment: Problem and Purpose Statements: Synthesize Theory/Theories for Program Development. Analyze Significance and Innovation (Literature Review). Develop SMART Goals/Objectives. Develop a Logic Model. Develop a Budget Strategy. Formulate an Implementation Plan. Develop a Preliminary Program Evaluation Plan The Final Program Plan
I'm seeking an experienced graphic designer who specializes in creating abstract artwork and has a solid understanding of anime, superheroes, and pop culture themes. The project involves: - Creating an abstract, graphic design for a t-shirt - Incorporating elements from anime, superheroes, and pop culture Ideal Skills: - Proficiency in graphic design - Familiarity with abstract design style...and pop culture Ideal Skills: - Proficiency in graphic design - Familiarity with abstract design styles - Knowledge and understanding of anime, superhero, and pop culture themes - Exceptional creativity and originality This project calls for a specialist who can blend these influences into a unique and aesthetically pleasing design. I greatly value open communication and frequent updates on ...
I need an experienced developer to extend my existing PHP SQL driven platform. This project revolves around adding innovative features to the current structure. . Your job will include: - Analyzing the current structure and proposing alterations to accommodate the new functionalities robustly.... sql, html, css only. No backdoor connections No hidden code Full transparency of code No ownership over code/project for developer No tip No access to server No zip file No extra payments No delays over 10 days. Need to run in sub folder. If no returning correspondence from developer for more than 24h the project will go to another developer. Live demonstration of progress. Other requirements may be applied prior to project start. Communication only trough f...
...develop a program that reads QR codes from multi-page PDF files and image files provided by our clients and extracts that data into CSV files. Due to format differences, existing AZURE OCR API have not met our requirements, necessitating a custom solution. ✔Specific Requirements: 1. Ability to read QR codes from multi-page PDF files, multiple PDF files, and image files such as JPGs and PNGs. 2. Capability to analyze the data within the QR codes and format it into CSV files. 3. Development must be done in either Python or JavaScript. ✔Skills Required: -Experience in development with Python or JavaScript. -Knowledge of OCR technologies and QR code reading techniques. -Experience in handling PDF and image processing. ✔Project Goals...
Website is Search bar at top configured/customized to suit new zealand cities/regions with auot complete
I'm seeking a proficient copywriter to craft engag...release: A press release needs to be concise, engaging and informative. The copywriter will be expected to create a document that piques the interest of journalists and potential customers. - Understanding of the target audience: The ideal candidate should have an understanding of the automotive industry, including car enthusiasts, automotive mechanics, and vehicle owners, and be able to tailor the copy to these audiences. Ideal skills and experience for this job include: - Prior experience writing for the automotive industry - Proficiency in crafting website content and press releases - Familiarity with the automotive aftermarket sector - Ability to understand and target multiple audience segments - Strong communication and...
I need a WordPress expert to work on a one-time task, which involves fixing bugs and updating plugins and themes. Key Requirements: - Bug fixing: The website currently has some bugs that need to be resolved. - Plugin and Theme Updates: Regular updates of plugins and themes to ensure that the site is up...should have extensive experience working with WordPress and be able to troubleshoot and resolve issues quickly and effectively. - Understanding of SEO: A good understanding of SEO principles and how they relate to WordPress would be a plus, as the primary goal of the website is to generate leads and sales. - Strong Communication Skills: The ability to communicate effectively and keep me updated on progress is essential. Please only bid if you can complete this task quickly and ef...
Here is a list of zip files on a US Govt website. You must write a Python program that uses a network library to download each zip file on this site, then find each .csv file in the zip archive, and copy each .csv file in each zip archive to a hard drive directory on the local windows machine. The directory will be "C:/MedicareDownloadFiles". The files cover the years 2017 to 2024. You may not hardcode file names ... you must extract the filenames from the above https URL. The fee for this will be $30. You must have it done within 60 minutes. Thanks for participating!
Bought together modification of wordpress sales page, At present, it is a function of wpc bought together, and pop-up windows have also been developed. You need to refer to the functions of the two websites "" and "", and the amount is $150. Working hours are 7 days. ★ Copy the functions and appearance of "": 1: Title: It is limited to only 2 lines of text, followed by「 ... 」to display, the same as the current title 2: Hover picture or title: display all title names 「Refer to the home page picture,v 3: Only display "selling price" 4: Move the tick in the upper left corner to the lower right corner 5: For mobile phones or sliders that reduce the screen, , 「4/1」of the product image will be left on the far
I'm in need of a skilled backend developer who can integrate data from a custom API into my WordPress site. The job involves retrieving product information from the API (we will give you the API key and visualising it through interactive charts on our WordPress website Please find the details in the attached file below. *****You can propose for partial scope of the project as well.***** K...propose for partial scope of the project as well.***** Key Requirements: - Backend Development: Proficiency in integrating APIs and working with WordPress is a must. - Data Handling: Experience with handling and processing product data is an added advantage. - Data Visualization: Ability to visualize data through interactive charts - Communication: Regular updates and clear communication on the ...
Here is a list of zip files on a US Govt website. You must write a Python program that uses a network library to download each zip file on this site, then find each .csv file in the zip archive, and copy each .csv file in each zip archive to a hard drive directory on the local windows machine. The directory will be "C:/MedicareDownloadFiles". The files cover the years 2017 to 2024. The fee for this will be $30. You must have it done within 60 minutes. Thanks for participating!
...creating, analyzing, optimizing, and reporting on campaigns for our diverse range of clients. Projects will vary in size and scope, and compensation will be based on agreed-upon hourly rates between myself and the client, making the assignments hourly-based rather than per project. The chosen candidate will work closely with me, as I will share information and closely monitor all activities and progress. Regular reporting on planned actions will be required to ensure alignment with project goals and expectations. Applicants must have a proven track record of success in Google Ads and Facebook Ads, with extensive experience in both platforms. Please provide references showcasing past work and demonstrating significant results achieved. If you are a seasoned expert in Google Ads...
...to port an existing monitoring program from Windows XP, written in C#, to a modern Windows version or to Linux. The program is currently written in C# Key Features: - Real-time monitoring: The program should be able to continuously monitor and display real-time data. - Data visualization: It should have the capability to present the monitored data in a graphical format. - Data logging: Record selected inputs/outputs at predetermine interval - Error logging: The program should be able to log any errors or issues that occur during monitoring. - Control: The ported program should support control features like: - Adjustment of monitoring settings: The user should be able to modify the monitoring parameters. - Remote control of monitored devices: The ...
I need a seasoned ASP.NET VB developer with a strong background in updating existing applications. You will be responsible for enhancing and improving the functionality of our current system. Ideal Skills and Experience: - Proven experience with ASP.NET VB - Competence in updating and maintaining existing applications - Strong problem-solving skills - Excellent communication and teamwork abilities Your application should clearly demonstrate your experience with updating existing ASP.NET VB applications. Please don't hesitate to include links to relevant past work.
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
Our system stacks various features on top of each other. The attached is our draft of our news feature. The left side will have an internal scroll bar which scrolls down to see more news items. When one comes in focus, the highlight bar on the right will update to show the one in focus. We aren't worried about the actual news item but would like to perfect everything else.
... and Blog. Key Tasks: - Your primary responsibility will be to manage and post content across these platforms multiple times a day. - Additionally, I'm looking for someone capable of creating engaging, high-quality content that resonates with our audience. - You will also be responsible for enhancing audience engagement and analyzing social media performance, providing regular reports on our progress. Requirements: - Prior experience in social media management, including Facebook, Instagram, TikTok, and Blog. - Proven track record in creating engaging, high-quality content. - Strong communication and marketing writing skills. - Proficiency in analytics and reporting. - A good understanding of social media platforms and their algorithms. - Consistency in posting content mul...
I'm looking for a skilled developer to create a P2P program specifically designed for Binance Merchant. The main goal of this program is to facilitate fast and secure transactions. Key Components: - The program should primarily focus on conducting transactions in a speedy and secure manner within the Binance Merchant ecosystem. - A user-friendly GUI interface is essential for the program. This will enable easy navigation and interaction for users as they conduct transactions. - The program should be compatible with the Windows operating system. It should run seamlessly and efficiently on this platform. Ideal Skillset: - Proficiency in blockchain technology and understanding of P2P transactions is crucial. - Experience in developing GUI interfaces i...
I need a freelancer to assist with accurate and efficient data entry into Microsoft Excel. The data is in digital format and involves numeric values. Key Requirements: - Enter numeric data into Microsoft Excel from provided digital sources - Ensure data is accurately transcribed - Maintain confidentiality of the data Ideal Freelancer: - Proficient in Micro...Requirements: - Enter numeric data into Microsoft Excel from provided digital sources - Ensure data is accurately transcribed - Maintain confidentiality of the data Ideal Freelancer: - Proficient in Microsoft Excel - Strong attention to detail - Previous experience in data entry, preferably with numeric data - Ability to maintain data integrity and confidentiality. Note: Please ensure you have a copy of Microsoft Excel for...
I'm in need of a seasoned graphic designer who can create high-detail vector files in AI format. These files will be used to engrave on products using a laser engraver. Most designs will be either lakes, rivers or cityscapes. Key requirements: - Delivering AI files: I specifically require Adobe Illustrator files for this project. This format is crucial for the compatibility with the laser engraver. - High-detail designs: The designs I need are intricate patterns and detailed images. They'll need to be converted into vector format without losing any of the complexity or quality. Ideal skills: - Proficiency in Adobe Illustrator: Prior experience with complex vector design and expertise in AI is essential. - Understanding of laser engraving: Knowledge o...
I need a skilled copywriter to create sales copy for B2B email marketing campaigns. The ideal freelancer will read through the attachment in this post and follow what is provided. - Write engaging, friendly emails that resonate with our audience - Utilize their expertise in lead generation to achieve our campaign goals - Have experience in B2B sales, specifically in the accounting industry The main objective of this project is to increase our lead generation, so if you have proven strategies to achieve this, we would love to have you on our team.
I have a high-quality generic domain that I need to sell. I'm looking for a professional who can help me with the process from listing the domain to transferring it to the buyer. Key Requirements: - Experience in selling domains, particularly generic ones, is a must. - Proven record of successful domain sales. - Familiarity with different platforms for domain sales. - Exc...attractive listing that highlights the domain's value. - Negotiating with potential buyers. - Assisting with the domain transfer process after the sale is complete. If you have a background in domain flipping and are confident in your ability to sell high-value domains, please get in touch. The successful candidate will need to be communicative, proactive, and able to provide regular updates on the progr...
I need assistance in copying product data from the manufacturer's site to ours. This is only for approximately 20-25 products. Key responsibilities include: - Transferring product descriptions - Moving over technical specifications The ideal candidate will have: - Proficiency in data entry - Understanding of eCommerce platforms, so that the formatting is correct on our site. Here is an example product: The description should be placed in our description tab. The other info, from Connections to Warranty should be entered in our Tech Specs tab, while retaining the formatting, including symbols. I will provide full URLs to each of the images in the tech specs. I do not want to link to their images. You will not need to do any image editing. I will provide limited access to the back...