Vb.net check if date is greater than punët
Hi muje kuch nhi samajra he ky ap Hindi me Bata sakte ho Date entry kr bareme plz
there is no greater victory than to fall from this world a free man. Nuk ka fitore me te mir se sa te ndahesh prej kesaj bote si nje njeri i lire
projekyi qe un do te bje do te permbaje foto dhe muzik , ai do te quhet jeta eshte e bukur ose life is beautiful. ai do te et me slide dhe levizje te ndryshme ,
projekyi qe un do te bje do te permbaje foto dhe muzik , ai do te quhet jeta eshte e bukur ose life is beautiful. ai do te et me slide dhe levizje te ndryshme ,
projekyi qe un do te bje do te permbaje foto dhe muzik , ai do te quhet jeta eshte e bukur ose life is beautiful. ai do te et me slide dhe levizje te ndryshme ,
I NEED A MLM WEBSITE IN PHP LANGUAGE LIKE THIS DEMO. CHECK THIS: USERID-admin PASSWORD-admin
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
pls ignore jjjvcxjvjxcjxj xvjuhfsvmxnvmxvnx xvkjxnvkjxcnvxjcnv xnxkjvnxjvnx shuhw fhsufsdf fushufs fsdf
12 358545054650090 111rt566ugu88hgr33edgi8onknfrxdsa45g78hvjutxcesyibboonngrexcsq13rfgyujhjiijnp0086yv54effewrrd6yviijbutfc4211r9u6gg4yvubgdwasvcrvh9onkppnh6y
12 358545054650090 111rt566ugu88hgr33edgi8onknfrxdsa45g78hvjutxcesyibboonngrexcsq13rfgyujhjiijnp0086yv54effewrrd6yviijbutfc4211r9u6gg4yvubgdwasvcrvh9onkppnh6y
check tha map ga hjf yaih;iohtwo gthjghou erherhyt5jjutyjtjy gkhjryjuryj hjtdhjtrutr ghhhktuc uktcfjtydjud jdtyjdyktukjuahn ntfjewatnyy54u dbbnjmrhgfhtyyerytrtrshtrshtrjstrjrytshgstrsthaeyhY3
check tha map ga hjf yaih;iohtwo gthjghou erherhyt5jjutyjtjy gkhjryjuryj hjtdhjtrutr ghhhktuc uktcfjtydjud jdtyjdyktukjuahn ntfjewatnyy54u dbbnjmrhgfhtyyerytrtrshtrshtrjstrjrytshgstrsthaeyhY3
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I'm seeking a skilled professional to design and build an AIS 140 standard GPS device with a primary focus on fleet management. The device will need to have the following features: - Real-time tracking: It should be able to provide up-to-date location information and movement status of the vehicles. - Geo-fencing: The device should support the creation of virtual geographic boundaries, and alert the control center when the vehicles breach these boundaries. - Fuel monitoring: It should be equipped with technology to monitor fuel levels in real-time, allowing for efficient fuel management. The device should support the following communication interfaces: - 4G/LTE: To ensure stable and fast connection for data transfer. - Bluetooth: To allow for wireless communication with other ...
We are a marketplace an have an excellent website (Build in Next Js) that is facing some indexing issues in google. I'm looking for an expert in programmatic SEO (pSEO) to help me resolve these issues. We currently have 3.8 M pages build through programmatic SEO and only 136K pages are indexed. Key Responsibilities: - Identify & resolve the specific indexing problems affecting my website - Suggest and implement strategies to improve website's indexing Ideal Skills and Experience: - Proven track record in SEO, with a strong emphasis on programmatic SEO - Expertise in resolving indexing issues - Excellent understanding of search engine algorithms and indexing processes - High proficiency in SEO tools and analytics Your insights and solutions will be critical in helpi...
Hi there, We are a travel agency looking for an expert in API integration to answer the following questions: Is it possible to connect and our own booking system to check and update automatically accommodation availability, rating, pricing and meals within our internal booking system? It should take into consideration a radius of 5-10km from a certain city point. Our own booking engine works automatically as follows, it sends a booking request to the accommodations on a certain accommodation list (from the first to the last one on that list) following a rule: if the first accommodation on the list denies our booking request, automatically the request will be sent to the second on the list, and so on. What will the requirements?
...e-commerce plugins like WooCommerce or Shopify, ensuring easy product browsing, cart management, and secure payment processing. - Custom Theme Development: The website's design should be tailored to fit a modern and minimalist style. The selected freelancer should be capable of creating a unique, visually appealing theme that reflects this aesthetic. Given that the main purpose of this website is to display information and a portfolio, the design should be clean, uncluttered, and user-friendly. Job Responsibilities: • Should have intermediate understanding and working knowledge of WordPress • Designing and building the website front-end • Knowledge of front-end technologies including CSS3, JavaScript, HTML5 and jQuery and REST/API integration • To...
I'm seeking a seasoned SEO specialist to perform a comprehensive audit of my website with a focus on improving rankings on Google. Key Requirements: - Audit: Review the current state of my website from an SEO standpoint. - Recommendations: Provide actionable suggestions to enhance my Goo...particularly with enhancing Google search rankings. - Strong analytical skills to assess the current website's SEO performance. - Excellent understanding of keyword research and optimization techniques. - Ability to provide clear and strategic recommendations for improvements. - Good communication skills to explain complex SEO concepts in understandable terms. This project would suit someone who is up-to-date with the latest SEO trends and can deliver tangible results. Looking...
I'm looking for an experienced WordPress developer to help small issues in a website . it's a very small job for an experience wordpress developer. please check attachment for the job
...required are: - Recovery: I need help with server recovery, the ability to troubleshoot and restore the server in case of failure. - Update: Keeping the server software up-to-date is crucial for security and compatibility. I need a specialist to handle the server updates effectively. Ideal skills for this job include: - Strong expertise in Linux server administration and management. - Proven experience with server recovery procedures. - Proficiency in updating server software without causing disruptions. - Strato dedicated server recovery - Operating system Ubuntu 16.04 LTS 64bit + Plesk Onyx (unsupported) - Ubuntu is outdated therefore weI cant login to the server - Execute : no hard reboot , no result - Executed : Recovery system: Rescue 64bit 4.x-Kernel , no re...
...using ChatGPT for content creation and customer engagement. -Strong knowledge of Shopify and its functionalities. -Excellent research skills and the ability to stay up-to-date with industry trends. -Exceptional copywriting skills with a keen eye for detail. -Strong organizational and time management skills. -Ability to work independently and meet deadlines. -Strong communication skills and a customer-focused mindset. Contract Details: -Duration: 6 months (July 2024 - December 2024) -Payment: Monthly payments, rate to be discussed based on experience. -Renewal: Opportunity for contract renewal in 2025 based on performance. If you are passionate about skincare, digital marketing, and creating engaging content, we would love to hear from you! Please submit your resume, a br...
I am in need of a skilled freelancer who can help me extract all products from an online shop and import...Key Responsibilities: - Extracting all products from an existing online shop - Importing/copying these products into my Shopify store I expect the freelancer to: - Ensure all product information is correctly ported over like variants, prices, ean/gtin, description, collections, Filters... - Maintain the quality of product listings - Ensure the product images are not lost during the import I'm looking to work with someone who has: - Experience with product extraction and import in shopify - Proficiency in Shopify - Attention to detail Please provide a timeline for completion when bidding. Please check the size of the shop and the number of products ()~ 8.000 Produ...
I need English speakers from across the globe for a two-month recording project aiming to record scripts through a conversation. Scripts to record regard many subjects like healthcare, business, games, law and tourism. Recordings will be performed through an app between two...speakers from across the globe for a two-month recording project aiming to record scripts through a conversation. Scripts to record regard many subjects like healthcare, business, games, law and tourism. Recordings will be performed through an app between two peoples forming a group, so teams of many english speakers are welcome, but if you are not a team and you have a person like a friend or a brother with whom you can record, you are still welcome to apply. Check the form joined below to know more a...
I'm in need of experienced SEO professionals to build high-quality backlinks with a DA of 30 or greater for my website. Key Requirements: - Expertise in SEO strategies and backlinking - Proven track record of increasing domain authority - Ability to deliver quality results within a set timeframe Please provide details on your approach to this project and the techniques you plan to use. Also, share your past experiences with similar projects.
I'm in need of an expert logo designer to create a logo that will fulfill three core purposes: 1. Boost brand recognition. 2. Represent my company's values. 3. Attract our target audience. Even though there aren't any specific...Attract our target audience. Even though there aren't any specific symbols or images I'd like integrated into the design, I do have a color preference - Brown. The logo will ideally capture and express our brand's uniqueness, reinforcing our identity in the minds of our audience. A successful freelancer for this project would have an impressive portfolio of past logo designs, and fluency in up-to-date design software. Understanding of color psychology in branding would also be an added benefit. I'm looking forward to s...
I'm in need of a web-based multi...primarily focuses on real-time inventory tracking. This software will be utilized by our warehouse staff to ensure products are correctly logged and easily retrievable. Key Features: - Real-time Inventory Tracking: The primary function of the system is to keep a close eye on the stock levels. - User-Friendly Interface: The software should be intuitive and easy to use for our warehouse staff. Integration: The system should have the capability to integrate with our accounting software. This is essential for keeping our financial records accurate and up-to-date. Ideal Skills and Experience: - Proven experience in developing inventory management software. - Familiarity with real-time inventory tracking. - Ability to integrate soft...
...calendar that notifies users of upcoming reports, events, and indicators that may impact the financial markets. We will need to find all the sources the main information comes from and scrape them using provided API's from the government sites that they provide usually. - SEC Insider Traders Page: This is a vital component of the website. It should include: - A list of recent insider trading activities: This will help users stay updated on relevant market movements. - Filter options by date, company, or individual: Users should be able to narrow down information based on their interests easily. I have already made most of the scraper for this SEC insider trader tool and just need it fixed slightly and optimized. - For the database management of all data I have ...
I'm seeking a skilled professional to help me design a unique watch that will include a date, time, and moon phase display. The watch should be designed to run on a battery-powered system, and the display should be either a paper or LCD screen. Key requirements: - **Display:** The watch should feature a paper or LCD display that can show the date, time, and moon phase. The size of the display will be determined by the type of screen you select; please consider the optimal size for viewing these details. - **Power Source:** The watch should operate solely on battery power. - **Moon Phase Feature:** One of the key features of the watch is the moon phase display. This should be accurate and easy to see. Ideal Skills and Experience: - Previous experience in desi...
I'm seeking an SEO expert and talented content writer who can effectively enhance the visibility of my website on a national scale. This project requires: - Generating 400 backlinks per month from domains with a DA more than 20. Techniques for generating these links should include guest posting, social bookmarking, blog commenting, article links, image links, forum links, classified links, and business list links. - Avoiding any websites with gambling or adult content, low-quality, spam, or DA less than 20 in the backlink creation process. Also will not be counted links from same websites (domain) used during previous 2 months (or last 2 monthly reports), links from different subdomains of a same used domain (Ex: and ), similar names of webdomains (Ex.:
I am looking for an experienced video editor to create an animated wedding invitation. The video will follow a whimsical, creative style, showcasing the authenticity of the couple's story. Key elements that need to be incorporated into the video are the couple's names and photos, and the date and time of the wedding. Ideal video editor will have: - Experience in creating animated wedding invitations - Good eye for detail - Ability to incorporate personal elements into the animation - In-depth understanding of storytelling through animation - Proficient in softwares like Adobe Premiere Pro, After Effects, Final Cut Pro, etc. Let's make an invitation that truly depicts us and the celebration of our love!
Experienced Web Developer for IT Managed Services Company Website Company: Tymor Technologies Description: Tymor Technologies, a leading IT managed services provider, is seeking a highly skilled and experienced web developer to design and develop a professional website that reflects our brand and services. The website should closely resemble the style and functionality of Ntiva, featuring a 3D logo and animations. The website will include over 25 pages of content, each with unique images and content relevant to the IT managed services industry. Key Requirements: Proven Experience: Demonstrated experience in web development, with a portfolio showcasing similar projects. Design Expertise: Ability to create a website with a modern, clean design similar to Ntiva. The site
...a set of changes to my existing web application. The application is built on .NET, C#, MVC and MSSQL. The main areas of focus are: - **Database modification(If need)**: - **Adding New Features(If Need)**: I'm looking to integrate some new features into the web application as per requirement. - **Front-End Modifications**: I need some enhancements on the front-end, focusing on design/UI changes as per requirement. Additionally, the project would also involve: - **Back-End Modifications**: These would be required to ensure the new features are implemented effectively. - **Bug Fixes**: Any existing issues within the application should be identified and rectified. The ideal candidate should have extensive experience in .NET, C#, MVC and MSSQL. A...
I'm currently in need of an HTML expert to take care of several tasks for me. The ideal candidate should have a proven track record in front-end development, responsive design, and creating HTML email templates. Required to create HTML for PDF generation and HTML should be A4 print compatible. Please check the attachment then let me know
I am in need of a freelancer with remarkable skills in data presentation and digital design to create a rich knowledge panel. The main objective is to accurately display my: - Basic Biographical Information: This includes my full name, date of birth, education, residence and work history. - Professional Accomplishments: Big emphasis on my various publications, practical experience and notable certifications earned over the years. A keen eye for detail and experience in professional branding are added advantages in delivering a remarkable outcome. The ability to visually communicate this data in a unique and engaging manner is key.
I need a customized formula in an Excel spreadsheet to ca...calculate different rates based on the day of the week. Here are my specific requirements: - The formula should apply different rates for weekdays, Saturdays, Sundays, and Public Holidays. These rates are as follows: - Weekdays: $30.10 - Saturdays: $36.12 - Sundays: $42.14 - Public Holidays: $60.20 - This calculation must be flexible and able to automatically adjust to the specific day in the date field. We will also add another box that adds11% to the total figures. Ideal Skills and Experience: - Proficiency in Microsoft Excel and its formula creation. - Experience in creating custom Excel formulas to calculate based on specific conditions. - Attention to detail to ensure the accuracy and functionality of th...
...fakes. i woud also like to know if they sell only ungraded coins or professionally graded coins, which are in plastic coin holders called slabs, which are plastic coin holders with a grade marked on them. so i would like : 1. identify good trustworthy coin shops or coin sellers that sell old thai coins (only thai sellers) 2. get pics of some of the silver coins and their prices 3. ask if the shop has professionally graded coins as well as ungraded coins so that you are not inconvenienced, and to keep your costs low, over the next month or so, you be able to find some coin shops as per the job description, go there if you are in the area anyway, and find the required items as per the job description and phtograph them and get their prices. or not only shops, if...
...equipment first. Assigned Personnel: Assign responsibility for each maintenance task to specific personnel or teams. This ensures accountability and clarity on who is responsible for carrying out each task. Completion Tracking: Include a column or section to track when each maintenance task is completed. This should include the date of completion and the name of the person who performed the task. Notes or Observations: Provide space for recording any observations or notes related to the maintenance tasks. This could include issues encountered, parts replaced, or recommendations for future maintenance. Flexibility: Ensure that the listing is flexible and easy to update as maintenance requirements change. You may need to add new equipment or adjust maintena...
I'm looking for a skilled Python developer to help me with a scraping project. I need to extract specific product data from a website's table. Skillset: - Proficiency in Python and Scrapy - Exp...website's table. Skillset: - Proficiency in Python and Scrapy - Experience in web scraping - Familiarity with handling web popups The website () contains a table with important product information. For each product, I need the following details scrapped: Certificate Type Certificate Number Product Type Organization Name Country Issue Date Expiry Date in addition to Product Details Brand Model Description Barcode The data should be saved in a CSV file. There are no specific rules or requirements to be followed during the scraping process.
...management system. Your role will include keeping track of inventory, ensuring that each platform has accurate stock levels, and that the product information is up-to-date. - **Sales and Traffic Generation**: Your focus will be on eBay. You should have a proven track record of driving traffic and generating sales on eBay. Experience in leveraging the platform's promoted listings and other advertising tools is a plus. - **Product Listing**: You will be listing electronics and gadgets. Experience in this product category is highly desirable. - **General Management**: I'll need you to manage the stores, handle customer queries, and process orders if necessary. Ideal Skills: - Proficiency in setting up and managing Amazon, eBay, and Spotify stor...
I am an emerging freelancer specialized in Excel, offering services in data analysis and routine work automation. With academic experience in handling complex Excel functions, I am poised to help clients streamline their operations and uncover valuable insights from their data. Key services include: - Crafting custom Excel spreadsheets for data analysis - Automating repet...the transformation of raw data into meaningful analysis - Opportunities to automate processes and enhance productivity Although I am at the early stage of my freelancing career, with my academic background and passion for Excel, I am eager to tackle challenges and deliver high-quality results. I am looking forward to collaborating with clients to help make their data work for them and achieve greater business e...
NextGen is seeking an experienced IT professional or team to deploy a private email server on our internal infrastructure. The goal is to enhance security, ensure data privacy, reduce dependency on third-party email services, and customize the email system to meet our specific needs. The project will involve setting up the server, configuring DNS records, installing and configuring necessary software, securing the server, and ensuring seamless email access for all users. Key Deliverables: Infrastructure Setup: Set up a dedicated server or VPS with a static IP address. Configure necessary storage and network resources. DNS Configuration: Configure MX, SPF, DKIM, and DMARC records to direct email traffic to the server. Software Installation and Configuration: Install and co...
I'm in need of a local freelancer based out of Noida, Greater Noida or East Delhi. The task involves visiting a residential property in Greater Noida near Yamuna Expressway. Here are the job specifics: - You will be responsible for using a smartphone to take pictures and videos of the property. - The coverage is expected to be basic, focusing on the main areas of the property. - The primary goal of this visual content is to attract potential investors. Ideal candidates for this project should: - Be based in Noida, Greater Noida, or East Delhi. - Possess a smartphone for capturing the visuals. - Have basic knowledge of real estate photography. - Understand the importance of targeting potential investors with the visual content produced.
hello, there, We need some Nativ...recording task, they are short sentences, the recording would take you about 15 minutes, the budget is $9 for the whole task the speakers need to be: -Age from 18-55, Both professional voiceover or amateur -Equipment: You just need to have a good phone. The recording script is in our recording app so you will need to download our recording app and then use task name we provide to log in and record. -Envrionment: Please record in a quiet room, no echo, no other noise like birds noise, car noise and so on. Don't need to use earphone or bluetooth. -Pronunciaiton: we will provide a few sample audios for you to check the pronunciation we need, you need to listen them first before starting the recording task If you are interes...
...should support and display pictures, sounds, and picture with sound content. Design and Branding: - I already have a specific design and branding in mind for the platform. You will be responsible for implementing this design. Generally: I want A ready-made education and training platform such as Udemy is required with the following requirements: Basic programming language php laravel.11 The website and source code are professional, tidy, clean and easy to use Open source platform is preferred by php Website design, ready-made designs can be accepted Excellent user experience High download and browsing speed Compatible and responsive with all devices, programs and screens English roll Dark mood Register with Google and Facebook Student...
I'm seeking a professional who can compile a precise B2B mail/email list for local small businesses in my city. Looking for someone to create me a mailing & email list of businesses within specific postcodes of Australia (there will be 20 postcodes) I'm not interested in an outdated existing list.. i want someone to do the work...in my city. Looking for someone to create me a mailing & email list of businesses within specific postcodes of Australia (there will be 20 postcodes) I'm not interested in an outdated existing list.. i want someone to do the work of collating a current list. List headers will include..... Business Name Business Principal contact (if obtainable) Business Email Business Phone number Business registered mailing address Business in...
...integration with QuickBooks Online. CURRENT: We have a QuickBooks Online application that syncs invoices from QuickBooks Online to two MySQL database tables (order headers and order lines). This application works correctly but we want to add a condition to the INSERT statement in this program so only invoices that have a custom field populated will get synced to these tables. The custom field name to check is "Online Order Number". Requirements: - Modify functionality of existing program to only INSERT records to MySQL table when invoice record contains a value in custom field "Online Order Number" The ideal freelancer for this project should have: - Proven experience working with PHP, particularly in customizing and enhancing applications. - A soli...
I am having trouble with authentication issues in the .NET framework. Specifically, the login functionality is not executing as expected. Details: - The issue is particularly with the login failures. - The problem is not that users can't login despite their credentials being correct, but rather the login functionality not executing as expected. Ideal Skills and Experience: - A deep understanding of .NET Framework - Proven track record in resolving .NET authentication issues - Experience in troubleshooting and debugging login failures - Strong knowledge in .NET authentication processes.
