Code sample project vb net punët

Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc

Desenvolvedor .NET MVC, SQL e ADVPL Protheus

...customers solving problems with deliveries, tracking parcels online (EestiPost, Omniva, DPD, TNT, FedEx, UPS, etc…) handling issues reported by clients with products delivered, managing issues in case of delays, making orders modification, invoice modification, address modification, managing communication about returns, disputes, refunds, etc… Quality assurance: performing quality inspection of the sample of the products manufactured in order to escalate with factories possible faults and quality fluctuations issues whilst following up with customers who have been affected by production issues. Online technical support and troubleshooting: supporting customers when payment error occur, issuing credit card refunds, spotting technical errors and mistakes on the ...

asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

Sample ghkjkjgkjgkjhgjkgjkgkjgjggkgjkgjkggjggjkgjgjkgjkgjkgjkgjkgjkgjgjgjgjgjkgkgjkgjgkjkgjkjgjgjkgkjkj

ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

hi i need support

I'm seeking a talented Marwari voiceover artist to provide a friendly and engaging voice for an e-learning module aimed at adults. Key Requirements: - Marwari Speaking: Fluency in Marwari is essential to convey the content effectively. - E-learning Experience: Experience...Speaking: Fluency in Marwari is essential to convey the content effectively. - E-learning Experience: Experience with e-learning voiceovers or similar content would be beneficial. - Engaging Tone: The content is designed for adult learners, so the voiceover should be friendly and engaging, but also professional. The successful applicant will need to record the voiceover remotely. Please include a sample of your previous work in your proposal, especially if you have experience with e-learning or similar voic...

I'm seeking a video editor to help convert text into engaging videos for a finance-related course. The main objective is to utilize some AI tools for text-to-speech conversion, followed by the creation of videos based on the generated audio. Requirements: - In spanish language - Videos should be between 1 and 5 minutes in length. - The ideal visual sty...footage that aligns with the audio. - Incorporate the male voice-over for the video. Skills and Experience: - Proficiency in video editing software. - Experience with AI text-to-speech tools. - Strong portfolio of creating engaging and informative videos. - An understanding of finance-related content is a plus. - Fluency in Spanish is highly preferred. Please share your relevant experience and a sample of your previous wor...

Hello, I have my Python/Django site hosted on PythonAnywhere and it's facing a NET::ERR_CERT_DATE_INVALID issue. Website : I would appreciate someone help to troubleshoot this issue and fix the NET::ERR_CERT_DATE_INVALID error, ensuring that the SSL/TLS certificate is correctly set up. - Website troubleshooting and error resolution - SSL/TLS certificate configuration. Thanks in advance !

I'm seeking an experienced DevOps engineer who is proficient in deploying React Frontend and .NET Core 8 applications to Alma Linux with NGinx server. The candidate should have solid experience with: - Deploying React FrontEnd and .NET Core 8 Web API applications on Alma Linux in GoDaddy VPS. - Knowledge of routing of both applications with one domain and one SSL. - Knowledge of handling SubDomain. - Knowledge of Alma Linux Nginx deployment. - Understanding of .NET Core Application Settings and React.JS application settings - Understanding of Node.JS

...lookout for a skillful graphic designer who can create a powerful logo for my brand called JMR. I want the letters incorporated with the crown I have included a sample for you to refer too. In the sample it has the word All things. Replace that word with JMR This logo should ideally convey the core values of professionalism and trustworthiness we stand for. I have not decided on specific colors yet and I am open to creative suggestions from the designer to come up with the perfect color scheme that enhances the brand identity. Ideally we wanted elegant emerald green or elegant royal blue or Gold The ideal designer for this project: - Should have a portfolio demonstrating a knack for creative logo designs - Must be proficient in major graphic design software - ...

...Must be living in (or nearby) Lima, Peru • Must be available in business hours (9AM - 4PM) to conduct the visit. • Has a camera or phone/tablet of quality with a camera, internet access Please see the attached file for the site visit guidelines. You are only required to deliver the pictures, video & observations and are not expected to put together a report like the Sample Report. For your reference, you can check the sample report of the site visit here: Note: Milestone will be released the following week after the site visit to give us time to organize the report and contact you if we need additional clarification....

...be to identify and reach out to TikTok influencers who are open to promoting products related to beauty and personal care. It would be required that they could make a video about our products and post it on their TikTok pages. We will provide a list of KOLs on TikTok. You will need to reach out to the KOLs on the list and ask them to accept business partnership. We provide them with the free sample product, they will use it, and make a video to sell the product. KOLs will get 20% of sales as commission. They are risk free. The risk is on us: they agree and make committment, but just don't make video after they received the products, which doesn't count a job done. For this task, you need to have a strong understanding of influencer marketing on TikTok, a good network...

...with editing the search module of my website. The primary focus of this project is on modifying the way images are retrieved then displayed in the search results. Key Requirements: - Modify the retrieval of images in the search results to use URLs for specific sizes as opposed to the current methodology of storing images locally and then displaying. - No specific enhancements are needed for the image thumbnails, just an adjustment in the retrieval and subsequent display methodology. Ideal Skills: - Proficiency in PHP and MySQL - Experience with implementing search modules in web development - Familiarity with retrieving and displaying images in various sizes - Strong problem-solving abilities to modify existing code It's crucial that the candidate has a keen eye f...

Small update to the android app. Change the payment gateway "cryptomus" to stripe. After that. Compile the code to obtain the apk version and an .aab version that will be used in the Google Play Store. In turn, upload the updated code to the app server. Send me the updated source code as well. The app is made on react Native, and the backend is Python. All the API's are made on Python. This may require modification in FrontEnd. in that case. You must be able to complete the project. Maximum budget $300

We are in need of an expert and versatile voice over artist who will present a cheerful and friendly vibe for our upcoming school announcement. The ideal freelancer for this project will: - Be fluent in English and Urdu. Bilingual candidates are strongly encouraged to apply. - Have an energetic and friendly tonality. - Be capable of producing a voice over with a duration of 1-3 minutes. "Indo embassy high school, near Masjid e Maaz, Millat Nagar, Noori Nagar, Hyderabad. India's 1st Online school with RFID automated Attendance system, Indo embassy high school, near Masjid e Maaz, Millat Nagar, Noori Nagar, Hyderabad, Well trained and dedicated Teaching Staff, Computer Lab Equipped with World Class Advance Technology, We provide well-equipped computer, physical, biological...

As a sports enthusiast, I am looking to create a dynamic website that provides live scores for various sports. In addition to the live scores, the website should also support live video streaming. For this, I'd like to use YouTube as the primary streaming service, as well as m3u8 links for specific content. I have a website sample if you would like. Key Features: - Live scores for a variety of sports - Embedded videos using YouTube and m3u8 links Subscription: - Email Subscription: Users can subscribe to receive updates and newsletters through email - Social Media Login: Enable users to easily log in using their social media accounts - Membership Registration: Allow users to create an account with the website for personalized content and services Ideal Skills: - Strong fron...

Confirmis () is a Singapore-based business information provider specializing in connecting businesses with global capabilities; comprised of industry veterans, Confirmis's business model is designe...goods, etc. REQUIREMENTS: • Must be living in (or nearby) Antalya, Turkey • Has a camera or phone/tablet of quality with a camera, internet access • Must be available during business hours (9 AM - 4 PM) on working days Please see the attached file for the site visit guidelines. You are only required to deliver the pictures, video & observations and are not expected to assemble a report like the Sample Report. Note: Milestone will be released the following week after the site visit to give us time to organize the report and contact you if we need additional cla...

...nearby) Pengkalan Weld, Georgetown, 10300 Pulau Pinang, Penang, Malaysia • Has a camera or phone/tablet of quality with a camera, internet access • Must be available during business hours (9 AM - 4 PM) on working days Please see the attached file for the site visit guideline. You are only required to deliver the pictures, video & observations and are not expected to put together a report like the Sample Report. Note: Milestone will be released the following week after the site visit to give us time to organize the report and contact you if we need additional clarification....

I am in need of a skilled developer to transform a Figma design into HTML and CSS code, integrate it into our existing website, and ensure it works flawlessly across all digital devices. The project has the following key aspects: - Conversion: The Figma design provided must be converted into HTML (latest version), Bootstrap and CSS code. The final product must match the design exactly, so attention to detail is essential. - Integration: The coded design will then need to be integrated into our existing e-commerce home page. Experience with e-commerce platforms and integrating designs is highly preferred. - Responsiveness: The final product must be fully responsive for any digital device. This includes but is not limited to mobile phones, tablets, and desktops. The i...

...and financial records. Liaise with clients and partners in support of awards sponsorship. Support the creation and distribution of event invitations, agendas, marketing materials, and ticket sales. Lead on outreach for Awards organisation (including for products’ entries, judges research, attendees) Oversee logistics related to Awards organisation (including the distribution of sample product from category entries to judges). Assist in coordinating event registrations, including managing RSVP lists and attendee communications. Provide on-site, live event support, ensuring the smooth running of our events with other event lead and the team. Requirements Experience in event planning and organising or supporting events in a workplace or voluntar...

I'm seeking a proficient translator to translate a set of approximately 100 documents (Safety Data Sheets for the cosmetics ingredients, appr. 3-4 pages long) from Japanese to English. The originals will be delivered in pdf and the translations should be delivered in Word files. The sample of three files for translation is attached, The ideal candidate should possess the following skills and experience: - Proven experience in translating technical documents from Japanese to English, - Strong command of both Japanese and English languages, - Attention to detail and ability to ensure precision in translation, - Previous experience in translating technical documents. The translation does not need to be certified. The main focus is on maintaining accuracy, clarity and for...

I need a skilled .Net MAUI developer to assist me with my existing project. The main tasks for this project include: - Fixing bugs: The project is currently experiencing some issues which are negatively affecting the user experience. The specific bugs are not provided in this brief, but I can share details during our discussion. - App Publishing: Once the bugs are resolved, you will be responsible for publishing the updated version of the app to both Android and iOS stores. - Delivery of the final source code and making sure it is running on our machine. The ideal freelancer for this project should: - Have a proven track record in debugging and resolving issues in .Net MAUI projects. - Be proficient in the publishing process for both ...

I'm seeking an experienced software developer with in-depth knowledge of AutoIt EXE files. The main goal is to unpack a specific AutoIt EXE version, 3.3.13 and help code in other languages (C# prefered) Skills and experience required: - Proficiency in AutoIt, especially in unpacking and analyzing its executables. - Strong understanding of Windows OS, as the unpacking should be done on a Windows machine. - Experience in producing detailed technical documentation is crucial, as I require comprehensive documentation on the process. In summary, the project involves: - Unpacking an AutoIt EXE 3.3.13 for code analysis. - Documentation of the unpacking process in detail. Please include your relevant experience and the estimated time frame for completing this task in y...

We are looking for a talented frontend developer to obtain sample songs from 20 famous singers and upload their songs and images to the frontend. We are developing an AI song generator web application. If you do well on this small task, you will be fully involved in the development and updates of the frontend portion of this dynamic project. The basic frontend has already been developed by one developer. Frontend update is required. Here are ten of the most famous singers of all time, known for their vocal prowess and significant influence in the music industry: 1. *Aretha Franklin* - Known as the "Queen of Soul," she is celebrated for her powerful voice and hits like "Respect" and "I Say a Little Prayer." 2. *Elvis Presley* - Often referred...

Need some expert guy on C# to solve some bug here on C# Code.

I need an experienced developer to conduct an in-depth research on Maptiler's iCloud mapping service and products. - Tasks: The main tasks will include the installation and setup...Specifically they should investigate the Maptiler iCloud product and demonstrate a full understanding of how the map usage and costings are regulated by Maptiler. The developer should demonstrate how the map usage can be controlled from within Maptiler and by their development techniques so that the map usage can be controlled within a certain monthly budget. In addition the developer should produce a sample page showing the integrated map with a few markers including Pop Up boxes on the location. Please, let me know if you're familiar with such services and if you have the capacity to carr...

...the .dxf extension, drawn at a scale of 1:1 in such a way that the points do not overlap and there are no gaps (polyline) - H profiles, square tubes, rectangular pipes on a separate sheet I am sending the sample documentation and a sample drawing of a shipping detail in PDF. You'll be provided with the necessary project requirements and it will be your responsibility to translate these into comprehensive fabrication drawings. These drawings are crucial for the construction process, so precision and attention to detail are a must. The ideal candidate should be able to understand the project requirements and visualize them in the form of technical drawings. Requirements: - Experience in creating steel fabrication drawings - Proficiency in CAD software,...

We are looking for a talented frontend developer to obtain sample songs from 20 famous singers and upload their songs and images to the frontend. We are developing an AI song generator web application. If you do well on this small task, you will be fully involved in the development and updates of the frontend portion of this dynamic project. The basic frontend has already been developed by one developer. Frontend update is required. Here are ten of the most famous singers of all time, known for their vocal prowess and significant influence in the music industry: 1. *Aretha Franklin* - Known as the "Queen of Soul," she is celebrated for her powerful voice and hits like "Respect" and "I Say a Little Prayer." 2. *Elvis Presley* - Often referred...

Hi David, I can't connect VSC to the Hostinger VPS. I can provide you with a file describing what I did and the problems I found. This project is about providing me with the instructions to connect VSC to the VPS and also provide the instructions I should follow to be able to edit the CrewAI files (using the CrewAI that you installed), namely pyproject.toml. , , , etc. I also need to know how to create a "tools" folder and edit files to create tools.

I'm in need of an experienced embroidery digit...converting them into embroidery files - A strong portfolio demonstrating successful digitization projects, particularly for clothing - Strong attention to detail to ensure the embroidery outcome is of high quality - Good communication skills to discuss design specifics and ensure the final outcome meets my expectations. A sample design has been attached. This is a 2inch x 2 inch pattern. It should be converted into an emb file. If you can do one sample then we can give you the project. We have about 20-25 designs that need to be converted into embroidery files. We will pay Rs.500 for the conversion of each design. If you possess these skills, and are familiar with the intricacies of embroidery digitization, then...

I'm in need of a C# expert with experience in SAML to implement user authentication and single sign-on (SSO) functionalities for my project. Basically we required a sample project how it work. Then our developer will continue from there. Key requirements: - Implement user authentication and SSO functionalities using C# with SAML. - Debug and resolve issues associated with these functionalities. - Collaborate closely with the project team to ensure seamless integration. The ideal candidate should have: - Proficient knowledge in C# and SAML protocols. - Extensive experience in implementing user authentication and SSO functionalities. - Ability to provide suggestions and improvement plans in a clear and concise way. - Prior experience working with existin...

Ideal Skills and Experience: - Proficient in C# programming language and .NET framework - Experience in developing desktop applications - Familiarity with Visual Studio - Ability to implement data encryption and database integration - Expertise in developing secure user authentication mechanisms Please provide relevant examples of your previous work in C# desktop application development.

I need a professional website that aptly portrays my investment advisory services and showcases my portfolio. The website should cater to individual investors, small business owners, and high-net-worth individuals. Key Features: - Detailed and clear information about my advisory services: Candidates with experience in creating informative and engaging content relating to finance or investments will have an advantage. - An investment portfolio section: The ideal freelancer should demonstrate an ability to elegantly display financial data in an accessible manner. - A contact form: Allow visitors to submit inquiries directly through the site. - An investment calculator: This needs to be user-friendly and visually appealing, requiring both frontend and backend capabilities. Ideal...

...We're looking for someone with a strong portfolio in branding and packaging design, especially within the accessories field. If you have the creativity and skills to bring fresh ideas and elegant solutions, please send us your portfolio. Let’s create something amazing together! This project involves Arabic-inspired products. Based in Kuwait ?? Thanks Plz read carefully before replying , your 1st understanding of the project will effect my decision..! Attached suggested logo and some references from the net .. regards...

We are looking for a talented frontend developer to obtain sample songs from 20 famous singers and upload their songs and images to the frontend. We are developing an AI song generator web application. If you do well on this small task, you will be fully involved in the development and updates of the frontend portion of this dynamic project. The basic frontend has already been developed by one developer. Frontend update is required. Here are ten of the most famous singers of all time, known for their vocal prowess and significant influence in the music industry: 1. *Aretha Franklin* - Known as the "Queen of Soul," she is celebrated for her powerful voice and hits like "Respect" and "I Say a Little Prayer." 2. *Elvis Presley* - Often referred...

...analysis midsection analysis L/4 partial analysis Shear design Hook anchorage length analysis Content must be included. This must be presented, so please carefully write an explanation in English next to each expression. In other words, make it like Sample, but the structure I'm looking for is exactly what Sample 2 analyzes. However, my object of analysis here is a slightly different length of beam, so I need to write an expression to reflect the difference. 1. write an expression to reflect the difference in the length of the beams, using the sample as a guide 2. write an explanation in English next to each equation. (I need to explain this in front of many people, not just after I solve it, so please write an explanation or interpretation principle for eac...

...analysis midsection analysis L/4 partial analysis Shear design Hook anchorage length analysis Content must be included. This must be presented, so please carefully write an explanation in English next to each expression. In other words, make it like Sample, but the structure I'm looking for is exactly what Sample 2 analyzes. However, my object of analysis here is a slightly different length of beam, so I need to write an expression to reflect the difference. 1. write an expression to reflect the difference in the length of the beams, using the sample as a guide 2. write an explanation in English next to each equation. (I need to explain this in front of many people, not just after I solve it, so please write an explanation or interpretation principle for eac...

I am seeking a qualified developer to build an online Rummy game specifically for the Android platform, equipped with a multiplayer feature: Key Game...equipped with a multiplayer feature: Key Game Specifications: - Multiplayer functionality: The game should facilitate multiple players at the same time to mimic real-life game play. This project does not require complex graphics - a simple, user-friendly interface with basic graphic detail is sufficient. Ideal candidate skills: - Experience developing Android apps - Understanding of multiplayer game architecture - Proficiency in Java and Android SDK This is a fantastic opportunity for developers interested in card games and multiplayer game structures. I look forward to seeing your proposal and sample works of similar...

...high-end individuals for a unique project. Key responsibilities: - Sourcing Billionaire Club Presidents: Utilize professional networking sites, exclusive events, direct outreach, and connections to identify suitable candidates. - Running Portfolios: Coordinate the portfolios of these individuals, tracking their performance and making strategic adjustments as needed. - Generating Portfolios via Events: Plan and execute events that attract potential club presidents and generate new portfolios. The ideal candidate should have: - Proven experience in sourcing high-net-worth individuals - An existing network in the business and finance world - Strong project management skills, especially in portfolio management - Excellent communication and negotiation skills This ...

I am looking for ...for AP Statistics. The ideal candidate would be familiar with the AP Statistics syllabus and can design engaging and educational content. Key Requirements: - Design a total of 33 learning guides - Formats to include PDF, E-book, and Word Ideal Skills and Experience: - Experience in educational content creation - Strong design skills - Familiarity with AP Statistics is a big plus File 1 is a sample learning guide to be designed. File 2 is a rough idea of what is expected from the designer I'm aiming for these guides to be both informative and visually engaging for students. Please note that you will be provided with 33 learning guides. The only thing to be done is given it an interresting layout with innovative and relevant graphics. You have not to ...

I'm in need of a creative and skilled content designer to help me in creating interactive and visuall...Create an engaging user experience to promote learning - Incorporate suitable graphics and visuals to aid in understanding Ideal Skills and Experience: - Proven experience in content design, particularly for educational purposes - Excellent grasp of design software and tools - Proficiency in creating engaging and interactive materials - A background in statistics or education is a plus File 1 is a sample learning guide to be designed. File 2 is a rough idea of what is expected from the designer. If you have a passion for creating educational content and are adept at making complex topics accessible, I'd love to hear from you. Please share your relevant portfolio items...

...a proficient individual who can write 20 Papers - each Paper at least 5 pages describing the critical tasks and AI Solutions on monitoring tools and Data Analytics. Each paper should consist of all the categories as attached sample along with diagrams and References. Attaching one Sample Paper for Reference. Key Responsibilities: - These Papers should be 100% plagiarism free and should not be detected under any AI Detectors - Should be able to Write Papers 20 Papers Total - 5 pages in each Paper - Explain the task in detail along with diagrams (Attaching the Sample) I'm looking for someone with: - Proficient English skills for clear communication. - Experience in data analysis, and the APM, Customer Experience tools. - Strong problem-solving skills and atte...

I am in need of engaging and interactive PowerPoint presentations for my Grade 5 Math classes. Expectations: - Create PowerPoint decks that cover the 5th-grade math curriculum. - Implement nic...in-person classroom setting. Ideal Skills: - Proficiency in PowerPoint and creating engaging presentations. - Understanding of the Grade 5 Math curriculum. - Experience in educational or e-learning content creation is a plus. The goal of this project is to make the learning experience more interactive and enjoyable for my students. This is a long term bulk order, I will be paying $2 for 1 lesson of PowerPoint. If you are not ok with this, please DO NO BID. Please also bid for 10 Presentations. Also, type in the bid "OK WITH SAMPLE" as I will be asking for a sample...

I'm seeking an experienced professional who can analyze selected architectural and structural plans from the viewpoints of fire safety regul...accessibility standards, and provide concrete recommendations for improvements. Key Tasks: - Thorough scrutiny of existing plans with a keen eye for code compliance. - Special focus on exit routes, fire suppression systems, and handicap accessibility features. - Presentation of clear, actionable amendments to ensure compliance with laws. Ideal professionals should have a strong background in architecture, structural engineering, and a deep understanding of fire safety regulations and accessibility standards. Experience with plan analysis and code compliance is a must. Knowledgeable opinions and clear communication will be essen...

...seamlessly with our online CRM. The app will receive live Forex data along with indicators via web socket. Key Features: Real-time Forex charts with multiple timeframes Integration of specific indicators provided through the web socket Option to switch between different currency pairs Customizable interface: users can select which indicators to display Push notifications for significant market events Sample Menu: Home News Market Accounts The app should be both functional and visually appealing, with an intuitive user interface that accommodates traders of all levels. The design should prioritize ease of navigation and effective use of the app's features. You will receive a specific set of indicators to include, but I welcome suggestions for improving functionality and u...