Simple programs in vb.net punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
Desgin an Admin Theme for simple HTML Web Site
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
We are seeking an experienced [VA] to help us with our company tasks such as social media posts, research data entry etc... The ideal candidate should have a strong background in [LinkedIn Job posting - data entry - Google drive/sheets] The tasks are very simple, however, this will be ongoing, daily work for the foreseeable future. Must be reliable and consistent in order to be successful in this role
Project to create a digital memorial (mini social network) platform for people to honor their loved ones. Our prototype is ready, and we'll develop it using C#/.NET for robustness and scalability. Link to website prototype: (Copy)?type=design&node-id=0%3A1&mode=design&t=jfwDURBhWcI72r1x-1 You don't need to strictly adhere to the prototype design; it's meant to showcase the elements within it.
I'm in need of a unique plastic rectangular frame with a net for a beach game. The net will be used for a game similar to spikeball that will be played on the beach. It is similar to a a game called beer dye commonly played at colleges so I need to have 4 holes in each corner that can hold a ball similar to how poole is played where the balls fall in a hole Key requirements: - The frame should be durable, water-resistant and suitable for the beach environment. - The net should be of high quality and appropriate for game play. - The overall design should be innovative and engaging. The ideal freelancer for this project would have experience in: - Industrial design with an emphasis on sports equipment or outdoor products. - Fa...
...optimize my .NET and Angular project. The main areas I need improvement in include: - Performance: The project currently suffers from slow loading times. I'm looking for a professional who can optimize the code to ensure faster loading speeds. - Code Structure: The backend code in particular requires attention. I want to restructure it for better readability and maintainability. - Routing and API Optimizations: I need someone to optimize routing and API calls to decrease loading times and improve overall project performance. -Lazy Loading, Eager Loading optimizations Ideal candidates will have: - Proficiency in .NET and Angular - Experience with optimizing projects for performance, especially in addressing slow loading times - Strong backe...
I'm in need of an experienced US telemarketer for a cold calling market research campaign to gather feedback on Pool Service companies (business statistics, size, etc.) and software usage. Your tasks will include making calls, asking targeted questions, and gathering and reporting certain information in Google Sheets. Required: Availability from 9a-5p EST on 5/13 and 5/14, ability to make ~500 domestic calls from US cell phone/number. Key Responsibilities: - Conduct a series of cold calls to to pool service companies to collect data on their business statistics (size, etc.) and software usage (offering $USD incentive for participation) - Collect feedback on which specific Swimming Pool software they use, Net Promoter Score (NPS), Likelihood to Switch to a...
I'm in need of an experienced .NET developer to help me build a cloud-based web application. I haven't settled on a specific type of database yet, so I'm looking for your expertise to guide me in selecting the most suitable option. The application should be developed using .NET Core and should include a Web API. Key Requirements: - Database Selection: I'm currently undecided about the type of database to use for the application. Your input in selecting an appropriate database will be much appreciated. - User Authentication: I would like the application to have user authentication capabilities, preferably integrated with popular social media platforms. - User Management: The web application should have user management functionalities. ...
I'm searching for an experienced professional writer skilled in crafting compelling applications for foundation grants. As an NGO, our focus is primarily on health – specifically running community health initiatives. The ideal candidate for this project should possess: * Proven experience in grant writing, particularly foundation grants * Familiarity with health-related NGOs * An understanding of community health initiatives Your job will be to weave our story and goals into a compelling narrative that highlights the importance and impact of our health programs. Through your work, we aim to secure necessary funding to continue and expand our community health initiatives. Please, in your bid, showcase past success stories in grant writ...
I'm in need of an experienced US telemarketer for a cold calling market research campaign to gather feedback on Pool Service companies (business statistics, size, etc.) and software usage. Your tasks will include making calls, asking targeted questions, and gathering and reporting certain information in Google Sheets. Required: Availability from 9a-5p EST on 5/13 and 5/14, ability to make ~500 domestic calls from US cell phone/number. Key Responsibilities: - Conduct a series of cold calls to to pool service companies to collect data on their business statistics (size, etc.) and software usage (offering $USD incentive for participation) - Collect feedback on which specific Swimming Pool software they use, Net Promoter Score (NPS), Likelihood to Switch to a diffe...
I am looking for an experienced developer to help me create a minimalistic PHP web app that can perform a few key ...- user registration, send email notifications and generate reports. Key Requirements: - User Registration: The app should have a simple user registration system. - Email Notifications: It should also be able to send email notifications to users. - Report Generation: The app needs to have the capability to generate reports. I'd like to gauge the freelancers' skills and competence based on their past work, so please include examples of your previous projects in your application. Ideal Skills and Experience: - Strong PHP development skills - Experience in creating user registration systems and handling email notifications - Familiarity with rep...
I need a straightforward MT4 EA with the following features: Strategy: The EA should open both buy and sell orders whenever a new candle forms. Take Profit (TP): Set TP to 50 pips for both buy and sell orders. Stop Loss (SL): Automatically close any open order when a new candle forms. Special Condition: If TP is reached for both buy and sell orders, the EA should wait for the next candle to form before opening new orders. Initial Lot Size: Start with a lot size of 0.01. Martingale: Enable Martingale strategy. Martingale Multiplier: Set the multiplier value to 2. That's all!
Please implement a one page website that is essentially a text editor similar to HemingwayApp dot com. For the full specs, please see the attached PDF file.
...quality of my applications before deployment, which re written in both JavaScript and .NET. This is a niche project where you'll be integrating the test suite into Jenkins for a continuous integration pipeline. Key Responsibilities: - Create robust Selenium tests for my applications, utilizing both JavaScript and .NET - Integrate the Selenium testing suite into Jenkins for continuous integration - Run tests efficiently and effectively in the pipeline - Identify and rectify bugs in the code before deployment Ideal Candidate: - Proficient in Selenium and JavaScript, as well as .NET and Maven - Prior experience integrating Selenium tests with Jenkins for continuous integration - Adept at identifying and fixing bugs in...
...help uncover crucial insights from our vast sources of data. Your technical acumen and in-depth understanding of statistical techniques will be instrumental for the role. The project's expectations include: * Applying statistical techniques like Descriptive statistics and Regression analysis to our data sets for in-depth understanding. * Identifying patterns and trends that give insights into our operations. * Evaluating the effectiveness of our current programs and implementations. The data for these tasks will mainly be sourced from our extensive surveys and databases. A keen eye for detail and a strong understanding of data manipulation and interpretation are necessary. Ideal Skills: * Proficiency in R for Data Analysis * Strong understanding of D...
I have two projects one that uses lidar sensor functionality and the other project is made for an autonomous car model, i want to integrate both Projects together to enable lidar sensor feature in my car model. to make car model have lidar sensor with another existed sensor.
I'm seeking a talented designer to create a Modern, Simple, and Catchy style pouch for a food product. It should exude a comforting, homemade aesthetic. Please note the use of a specific color palette which will be provided. Ideal skills and experience: - Expertise in package design, specifically pouches - Experience with food products - Computer Rendering Skills. - Understanding of rustic and traditional design themes - Ability to work with specified color palettes.
I'm in need of a talented and reliable developer who can implement a machine learning model in .NET Core for a simple time series prediction task. Key Requirements: - You'll need to utilize machine learning techniques to create a model capable of predicting daily /hourly visitors as we have data for each enterance. - The model must be suitable for .NET Core and efficiently integrated into the existing system. Ideal Skills and Experience: - Proficient in .NET Core - Strong understanding of machine learning algorithms, particularly those suited for time series prediction. Please note that the specific machine learning algorithm to be used was not specified, so you'll need to have a versatile understanding of various algor...
Hi. I need help to setup the binding for a RichTextBox .NET Control so that data is retained. There may be use of VBA that is needed. This is within a FactoryTalk View SE version 14 application. I don't know .NET or VBA, I am a FactoryTalk guy though. Example use case: Lets say a factory has 100 valves. If a user opens popup for Valve #3, I need a text box field in that popup for the user to enter data, and then data is preserved/saved. That popup should be one common FTV display that references the Valve_# that was selected (using parameter files, or...). This example is the main objective. I need a simple and easy solution to this, and I need to understand how to do it myself afterwards. This is perhaps a 1 hour job. My name is Marc. I...
Simple website with a responsive design for mobile and PC. I have templates for both versions; each contains only a few images and a brief text, although the designs are quite different from each other. The development must be carried out using exclusively pure HTML and CSS code, without employing WordPress or others.
I'm in need of an experienced developer who's well-versed in ASP.NET and VB.NET. The project involves the event pages i need where user can login and acess the event throught calender with specific functionality.. i will share feature to slected one ... Ideal Skills and Experience: - Proficiency in ASP.NET & VB.NET is a must, with a proven track record of projects involving user authentication and database integration. - Strong understanding of SQL Server databases and how to effectively integrate them into a .NET environment. - Experience in implementing user authentication systems that cater to both roles and individual accounts. This project requires a developer who can deliver secure and efficient user authentication and database int...
I am seeking an UK based experienced Golang Developer to build a robust and secure Go program that manages updates for another Go executable. This project requires creating a system that monitors GitHub to automate the process of updating, running, and, if necessary, rolling back an executable in a restricted Linux environment. Responsibilities: Develop a program that checks for new versions of an executable stored on GitHub and updates the running executable accordingly. Implement functionality to run the updated executable and perform startup tests to ensure its stability. Design a rollback mechanism to revert to the previous stable version if the new version fails at startup. Incorporate signature verification for each new executable to maintain security and authenticity. En...
I'm seeking an experienced C# developer to port a python webapp app to a C# web app (most likely ASP .NET with RazorPages). There is no database, all the data comes from an existing API. Key Skills & Experience Required: - understanding the fastapi + jinja templates (python based) - Hands-on experience in developing RESTful APIs using C# - simple and clean code - data serialisation The entire app has 100 lines of code + ca 100 lines of HTML template There are 3 buttons and about 6 endpoints Task: GIVEN: A simple webapp in python (fastapi + jinja) RESULT: - A webapp with the same functionality based on C# - it should be easy to understand / clean code - data serialisation as in the python app / template - short documentation (depe...
I'm looking for a skilled developer to change and develop an existing Hebrew language learning website, based on C sharp. Dot net. MVC. - The website is primarily focus on teaching the Hebrew language . - It should have interactive language exercises and grammar lessons. Ideal Skills: - Proficient in web development on C sharp. Dot net. MVC..
I am seeking a knowledgeable freelancer who can install and customize Trafft scheduling software on my website. Specifically, your tasks will include: - Customizing booking form design - Configuring...Configuring time slot settings - Setting up email notifications -Setting up sms notifications Most importantly, I'll need you to integrate this software with some of the tools I regularly use. These tools include Zapier, Google Calendar, and Stripe Payment Gateway. The successful candidate should have experience with these programs, as well as expertise in scheduling software customization. Familiarity with Zoom is also an advantage, as I might need this platform integrated in the future. Remember, this project goes beyond installation—it calls for customi...
MUST READ FIRST =============== MUST HAVE - Blazor experience of at least 3 years - Latest version of .NET & SQL Server - At least 1 hour of availability between 6:00PM and 11:00PM EST - Your price is the one that you REALLY want to have with 10% +- NOTE - APIs will be provided (you will not develop APIs) - No development will be done on My Computer. - DO NOT APPLY if your fees can exceed 10% or your bid PROJECT I have C# Blazor Web App that works using SQL Server Database & using APIs at the same time. For the functions that use the database, I want to replace them with the APIs 1- Make code debuggable. 2- Error message appear with no details, need to make the error message has Show More to display the details of the error. 3- Load Codes from APIs instead of loadin...
We're looking for someone experienced in installing SSL certificates on Azure hosting. We run two .NET based sites on a single Azure instance - they are: We have control of the domain, but need to work with our client for control of the subdomain. We will purchase a multi-domain Comodo SSL certificate from NameCheap (potentially a new PositiveSSL Multi-Domain certificate again) and have you activate it and install it on the Azure service. The current SSL is due to expire on the 28th May 2024. Key Requirements: - Install the SSL certificate on an Azure instance hosting my two .NET sites. - Ensure that both sites are configured to
I'm looking for a basic React web page with side slide panels. This project is a proof of concept, so the side panels should be empty – they don't need to have any internal functionality other than opening and closing. The main goal is to create a ...with side slide panels. This project is a proof of concept, so the side panels should be empty – they don't need to have any internal functionality other than opening and closing. The main goal is to create a clean, light-colored design that's responsive on both mobile and desktop devices. Key Requirements: - Simple, clean React web page - Two empty side slide panels - Light-colored design - Fully responsive on mobile and desktop Ideal Skills: - Proficiency in React - Experience in UI/UX ...
I'm looking for a developer experienced in .NET Core and Umbraco to make modifications to an existing Umbraco project. The main focus will be on changing the CSS and the Free Trial form, which needs to be integrated with a CRM system. Key Requirements: - Proficiency in .NET Core and Umbraco - Skilled in CSS customization - Experience with CRM integrations - Understanding of user authentication in Umbraco The main tasks include: - CSS changes to improve the overall look and feel of the site - Customizing the Free Trial form, particularly: • Layout and design adjustments • Integration with a CRM system for effective lead management Your expertise in Umbraco components, particularly in navigation menus, contact form...
...starting a business in the financing/lending industry specifically around Exotic and Collector Cars. I need a comprehensive market research and Total Addressable Market (TAM/SAM/SOM) analysis specifically focusing on the exotic automotive lending industry. Key Points: - Industry Focus: Exotic Automotive Lending - Information Required: - Market size and growth potential - Competitor analysis - Customer demographics and preferences Target Audience: - High net worth individuals - Car enthusiasts - Exotic car dealerships Ideal Freelancer: - Proven experience in market research and TAM analysis - Specific experience within the automotive or lending industry would be a plus - Ability to synthesize data and provide actionable insights - Understanding of the dynam...
I'm releasing a book (a gay romantic fiction) in the summer under a pseudonym, and I want to have somebody take photos of the book with parts of their body in the frame in a way which will be very shareable on Instagram / Tiktok / Twitter etc. The photos would not feature your face. Example photos might be: - The book on your bed, while your legs are either side. - The book in your hands while you sit cross legged on the sofa. - The book resting on your torso is the sort of thing I have in mind. Requirements - Young (18+) white male - UK-based (so I can easily post my book to you) - Preferably has an e-reader (to include my ebook in the shot) but not essential - Physically attractive arms / legs / torso (no faces necessary)
I am seeking a skilled .NET developer to create a Windows application with the following features: - User Authentication and Authorization: The application should ensure secure user access and have roles-based permissions. - Database Integration and Management: Experience with handling complex data and ensuring its security is essential. - API Integration: The application needs to communicate with external systems through APIs. My primary concern is scalability. The application must be designed to grow and handle an increasing number of users without compromising performance. Hence, I am looking for a developer who can plan and implement a scalable architecture from the very beginning. The ideal candidate should have: - Proficiency in .NET framework, particularly fo...
we have issues with getting dropzone to work on our website that is built with .php. So we just need someone to fix so we can upload files on one page and the files are getting sent to the server.
I am in need of an experienced illustrator with a sharp eye for architectural style and medium-level detail. Your task will be to convert about 100 of my basic 2D and 3D architectural line art illustrations into 3D line art illustrations. The output can be in colourful or black and white, but they should be visually appealing and clean. Ideal Skills: - Proficiency in creating architectural style illustrations - Experienced in creating detailed illustrations - Ability to transform 2D designs into 3D line art The architectural style should be modern, keeping the design minimalist with an emphasis on detaild, cleanliness and appeal. Your creativity will be greatly appreciated in this project, and I look forward to seeing your innovative approaches to this...
I am in need of an experienced illustrator with a sharp eye for architectural style and medium-level detail. Your task will be to convert about 100 of my basic 2D and 3D architectural line art illustrations into 3D line art illustrations. The output can be in colourful or black and white, but they should be visually appealing and clean. Ideal Skills: - Proficiency in creating architectural style illustrations - Experienced in creating detailed illustrations - Ability to transform 2D designs into 3D line art The architectural style should be modern, keeping the design minimalist with an emphasis on detaild, cleanliness and appeal. Your creativity will be greatly appreciated in this project, and I look forward to seeing your innovative approaches to this...
I'm in need of a professional app developer to build a comprehensive fitness application. The app should cater to both iOS and Android users and encompass workout routines and activity tracking. Key Features: - Workout Routines: The app should offer the possibility for me to upload my video-exercises, classes, and different workout programs. - Activity Tracking: The app should have a built-in feature that allows users to track their daily activities and tasks. This can be done through checklists. - The app will need to be translated in two languages: English and Italian (I will be able to provide with the translation after the english part is finished). The app will not require integration with any third-party fitness trackers or devices. Skills and Ex...
...the website is optimized for search engines. Ideal Candidate Profile: - Prior experience in SEO for financial services, particularly in the offshore industry, is highly desirable. - Proficient in conducting keyword research and analysis. - Proven track record of increasing organic traffic and improving search engine rankings. - Familiarity with SEO tools like SEMrush, Moz, or Ahrefs. - Strong analytical skills to monitor and report on the performance of SEO strategies. Target Audience: - Businesses interested in offshore financial solutions - High net worth individuals seeking wealth management services - Individuals looking for offshore banking and company formation If you have a solid background in SEO, particularly within the financial ser...
I require an experienced graphic designer to create a vi...touch that would help my brand stand out. The logo must tastefully incorporate my company's initials or name, making it memorable to my target audience. - Essential Skills and Experience: - Proven experience in designing unique and impactful logos - Strong understanding of color theory and combinations - Ability to create designs that are bold and vibrant - Proficient user of Adobe Illustrator or similar programs - Adept communicator with a keen eye for detail By creating a logo that captures the essence and personality of my business, you'll be playing an integral part in the journey of my brand. It's not just a design task; it's a way to show the world who we are as a company. ...
...developer to upgrade my ComicBase Mobile app, currently running on Xamarin, to .Net Maui. The app is utilized on both iOS and Android platforms. Key tasks include: • Deliver full conversion from Xamarin to the latest .Net Maui framework • Replace the current ZXing barcode library • Determine and implement a suitable alternative barcode library like , or others that meet my project specifications (refer to the attached requirements) - Add lesser fixes and update requirements (see attached) • Ensure compatibility across both iOS and Android platforms The ideal candidate should have: • Extensive experience in Xamarin and .Net Maui • Deep understanding of barcode libraries • Proven track record in app d...
I need a simplistic, one-page website linked to a database. This page will have limited content, including a logo and a 'check authenticity' button. The database will be provided in an Excel sheet format, and must be integrated seamlessly into the page. Key Requirements: - Develop a one-page website - Integrate an Excel database for product authentication - Provide a clean, simplistic design Ideal Skills and Experience: - Experience in web development, particularly one-page websites - Proficiency in database integration, specifically Excel - Ability to create clean and minimalist designs - Strong understanding of web security and authentication processes
...reinforcement required in the beam Loading of the piles to be specified Once designed be able to produce a 3D model of the beam showing concrete outline, heave protection and all reinforcement which is animated into a construction sequence The reinforcement must be detailed in accordance with British Standards and to allow for offsite fabrication (splice bars) The designs are for similar applications so after the initial input it should just be a case Proficiency in programs such as AutoCAD, Revit or Tekla Structures will be beneficial. Design will be required to be turned around within 2 days - but understand the first few may take longer There may be some temporary works design for earth retaining structures to do in addition Skills and exp...
Need someone to help in simple bug fixing error who has experience in android apps and knowledge about it Requirements are Coding skill Android knowledge
I'm seeking a skilled database developer to help me successfully migrate my database from .NET Framework 4.8 + EF6 + AspNet Identity to .NET 6 + EF Core + Identity. The database size is small - less than 1 GB, but it's crucial that user data is meticulously preserved during this transition. Key Tasks: - Perform data migration without any data loss. - Ensure the user login system and roles functions seamlessly in the new system. Ideal candidate should have: - Proven experience in .NET Core and EF Core migrations. - Strong attention to detail, particularly regarding user data. - Proficiency with user login systems in a .NET environment. Attached is the project source.
Hello I need an experienced programmer willing to take a project that requires attention to detail and precise understanding of the subject matter. I can give extensive details about the ideal functioning of the spreadsheet I need done, however, this is an overwview: Track all gross/net profits track all account balances track all bank balances track all ongoing and completed bets on each account track across futile types of bet single and sequenced (this will require custom logic) as well as more basic things. im looking of a single place for everything to happen and for the right person to create it. No work will need to be done with external API this is only an internal management and accounting system.
Se debe mantener un sistema hecho en .Net el cual esta vinculado a una base de datos SQL Server de Microsoft. El postulante debe manejar a la perfeccion el idioma Español.
Hello. I need a freelancer who can make me a beautifull instagram post with title, image, description and 5 popular tags based by my description.
