Vb.net punët

Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc

Desenvolvedor .NET MVC, SQL e ADVPL Protheus

asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

### Description: I am seeking a skilled software developer to integrate Arabic language support into our existing font generation system developed in C#. Currently, our system supports multiple languages but lacks comprehensive support for Arabic. ### Requirements: 1. Strong proficiency in C# and .NET Framework. 2. Experience with processing and analyzing texts in various Unicode encodings. 3. Ability to effectively implement and integrate UTF-8 encoding into the existing system. 4. Previous experience with font systems, particularly in Windows environments. 5. Ability to use diagnostics and debugging tools to identify and resolve issues. ### Objectives: - **System Update**: Enable the system to generate fonts that support Arabic script. - **Bug Fixes**: Address any encoding and d...

I require an expert in both C# and AWS to build a AWS Lambda function using .Net Core. The function should create a simple message in the SQS queue. The deliverables should include: 1. AWS Lambda Function: The AWS Lambda function should be capable of both Asynchronous processing and Dead letter queue. It should be written in C#. 2. Serverless Template: A serverless template is required that will be used by our gitlab pipeline to create the queue on AWS account. This template should be comprehensive yet efficient. 3. Gitlab YAML: Lastly, a gitlab yaml will be needed to facilitate the Lambda's deployment. Ideal Experience: - Highly skilled in C# programming - Extensive experience using AWS services - Familiarity with serverless templates - Understanding of Gitlab YAML for depl...

I'm in need of a skilled .NET developer to create a functional web application that mainly handles user registration, login, and database management. Key Requirements: - User Registration and Login: The application should have a robust system for users to sign up, log in, and manage their accounts securely. - Database Management: Proficient database management within the application is a must. This includes data storage, retrieval, and manipulation. Additional Information: - External Integrations: There is a possibility that additional integrations may be required in the future. Experience with integrating external systems and APIs would be beneficial. - User Roles and Permissions: The application may need to support multiple user roles and permissions. While this is currentl...

I'm in need of assistance with setting up a .NET project locally from a repository hosted on GitLab. Here are the finer details of what I need: - Configuring dependencies - Ensuring a proper setup for local execution. - Setting up the project to run on a test Slack account. Ideal freelancer would possess strong .NET and GitLab understanding and hands-on experience, combined with the knack for effective problem-solving. Must understand Slack and Slack Bots for this project to actually work

I need an expert to host my new .net MVC website on HostGator for its affordability. - Given that this is a new website that is content-based, efficient hosting is key here. - You should have extensive experience with .net MVC and HostGator, ensuring a seamless transition. - Ideal skills would include a solid understanding of .net MVC, HostGator, website hosting, and CMS systems. Your expertise in hosting will be key to this project's success. - I appreciate quick communication and updates on the project’s progress. - Lastly, any tips for maximizing the site's performance on HostGator based on your experience would be appreciated. Please only bid if you have the necessary skills. I look for professional responses and attention to detail.

I'm in need of a skilled web developer highly experienced in both Angular and Javascript. The primary objective for this project is to create a website with a responsive design that aligns with my provided brand guidelines. Key Qualifications: - Proficient in Angular and Javascript - Extensive experience in responsive design - Extensive experience in .Net Core and SQL Responsibilities: - Adhere to design and branding guidelines during web development - Create a website that is user-friendly on all devices. Please ensure to provide examples of past work with responsive web design during your application.

I'm in need of a skilled developer who can create unofficial APIs for UPI Apps and IRCTC Connect, and integrate them into a my c# .net desktop application. Ideal Skills & Experience: - Proficiency in analyzing Apps network traffic, api endpoints, APIs with a strong understanding of UPI and IRCTC Connect - we need API only and encryption methods, data should be stored/retrieved in json format. The APIs for UPI Apps should handle: (Flipkart/BHIM AXISPAY/FREECHARGE/PHONEPE/PAYTM/MOBIKWIK/GPAY - any3 Only) - User registration - Listing of added banks - Checking the account balance - Handling pending/approved payments The IRCTC Connect APIs should offer functionalities such as: - User login - Searching for trains - Submitting passenger details I'm looking for someone ...

I am seeking an experienced developer to resolve a CORS error present in my .NET 8 website. I am learning full stack development. I created a web-api project in .net 8 which is having simple login, register and account controller and it works perfectly fine when I test using postman. Then, I develop a simple website in react and typescript to consume my web-API. And now I get CORS error. If you work with me, You need to resolve my CORS and probably authentication issue. Acceptance criteria: 1. signup should work (all coding done you only need to troubleshoot the CORS issue) 2. Login should work and JWT token return (all coding done, probably you need to check if I have done correctly) 3. after successful login user details (just few details) displayed on account page

I am a .net leaner, and I'm in urgent need of a .NET expert to resolve an issues relating to Cross-Origin Resource Sharing (CORS) and JWT token authentication in my .NET 8 project. I'm using the framework for handling JWT tokens and need assistance in ensuring it's properly configured to work with the CORS policies in place. Key Tasks: - Fixing CORS issues: I'm experiencing CORS blocking and Preflight request failures in my project, - JWT Token : it works fine when I tried with postman for not working when calling by my front end app. Ideal Candidate: - Proficient in .NET - CORS & JWT Troubleshooting: Experience in resolving CORS issues, preflight request failures, and JWT token inclusion problems is essential for this task. - :

...to (we have already converted 50-60% to ) and also transfering our .NET to .NET CORE and our MS SQL to PostgreSQL Details of our current project STACK can be seen here -> Prerequisites: For this optimization task you can bid your normal hourly rate but for the long term project the starting wage will be as stated below. 1) Accept initial hourly rate of U$5.00 2) Accept and start work immediatly 3) Have 20+ hours a week for long term ongoing support and development. 4) If you are awarded the project accept IMMEDIATELY 5) Work hours: predominantly 20:00 to 03:00 (UTC -3 Brazil TIME) 6) Be available to work on weekends. Our projects use: GITLAB -> , ag-grid, C#, .NET API, MS SQL 2017 , WooCommerce digital product sales This is for ongoing long term

As a professional with a long standing .NET background, I need expert assistance with my existing website. The tasks I require help with are in the realm of backend and web development. The main goal of this role will be associated with functionality improvements and performance optimizations in the existing website. Ideal candidates will possess: - Expertise in .NET Backend and Web Development. - Proven history of enhancing website functionality. - Proven track record in performance optimization. - A meticulous eye for detail to ensure smooth and efficient implementation of changes without disrupting the current operations.

Przygotowanie oraz optymalizacja kampanii - Google ADS / Facebook ADS dla sklepu internetowego https://sklep.pat15.net. Katalogi produktów są utworzone i przesłane do Google Merchant Center oraz Katalogu Facebook. Kampania skierowana na konwersję - sprzedaż zakończona sukcesem. Można wykorzystać remarketing i kupony zniżkowe na porzucone koszyki.

I'm seeking a C# .NET 4.7 expert to help me with my WinForms application. It's currently facing a few challenges, namely slow performance, interface design, and error handling. I'm looking for someone who can not only assist in addressing these issues but also provide insights on how to enhance the software in general. Key Responsibilities: - Analyze and address the slow performance issues, which include frequent freezing, slow loading times, and laggy UI response. - Revamp the interface design to make it user-friendly and visually appealing. - Improve the error-handling mechanisms in the application to ensure a smooth user experience. Ideal Skills and Experience: - Proficiency in C# .NET 4.7 and WinForms development. - Strong experience in optimizing softwar...

Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.

I'm looking for a skilled ASP .NET web developer to work on a small project. Key requirements: - Fullstack development: The project involves both front-end and back-end development. The ideal candidate should be proficient in C# and ASP .NET. - Database Integration: The project will be using SQL Server, so experience with this database type is needed. Skills required: - Proficiency in C#, ASP .NET, and SQL Server - Experience in fullstack web development - Strong understanding of database integration and management Your role will be to take the project from concept to completion, ensuring that all elements are well-integrated and functioning smoothly. If you are a reliable, detail-oriented developer with a strong track record in ASP .NET web projects, I&...

I'm in urgent need of an ASP.NET and VB expert to help with my ongoing project. The individual should be able to optimize code and implement new features. Key Tasks: - Code Optimization: The project is facing performance issues. I need assistance in refactoring the code to improve efficiency and speed. - Feature Implementation: There are new functionalities I want to incorporate in the project. The ideal candidate should be able to seamlessly integrate these features into the existing system. Skills and Experience: - Proficient in ASP.NET and VB - Previous experience in code optimization is a plus - Ability to implement new features - Strong problem-solving skills - Excellent understanding of software development lifecycle. This is an immediate job, so I need someone...

Buscamos incorporar especialista programador .net freelance con conocimientos en: c# .net, asp, sql server se valorará experiencia en: integraciones api, en back-end y front-end. Trabajo principalmente en remoto, para colaboración continuada en desarrollos propios de nuestra empresa, con un mínimo de 40 horas mensuales.

I'm in need of some assistance to develop a .NET8.0 program with expert level ...the project include: * Command-based user interface Critical aspects of the project include: * User Interface: The program will run on a command line interface. It is essential you have experience in this rather than GUI/Web-based interface design. * File handling: For effective data management, we require user interface functionality. Experience in properly implementing this within a .NET application is crucial. Bringing these aspects together to create a seamless program is the ultimate goal of this project. The right candidate will have extensive experience in C# programming, specifically with .NET8.0, and a good understanding of command-based user interface design and user-interface...

I'm currently using .NET MAUI 8.0 to develop an educational app. I'm in need of a skilled .NET MAUI Expert to assist me in running the app in release mode specifically in the iOS simulator, focusing on iPhone. Ideal Skills and Experience: - Proficient in .NET MAUI 8.0 - Experienced in running apps in release mode - Prior experience with iOS simulator - Familiar with testing on iPhone

I'm in urgent need of an ASP.NET and VB expert to help with my ongoing project. The individual should be able to optimize code and implement new features. Key Tasks: - Code Optimization: The project is facing performance issues. I need assistance in refactoring the code to improve efficiency and speed. - Feature Implementation: There are new functionalities I want to incorporate in the project. The ideal candidate should be able to seamlessly integrate these features into the existing system. Skills and Experience: - Proficient in ASP.NET and VB - Previous experience in code optimization is a plus - Ability to implement new features - Strong problem-solving skills - Excellent understanding of software development lifecycle. This is an immediate job, so I need someone...

Do wykonania jest aktualizacja kilkunastu podstron (odświeżenie wyglądu na bardziej nowoczesny) na naszej stronie internetowej. Głównym językiem strony jest język polski. Podstrony przed: https://pat15.net/kontrola-dostepu-i-rcp/ https://pat15.net/gadzety-reklamowe/ Podstrony po zmianach (czyli efekt który chcemy osiągnąć): https://pat15.net/strony-internetowe/ https://pat15.net/systemy-alarmowe/ https://pat15.net/serwis-komputerowy/ Ważne jest zachowanie zasad SEO (h1, h2, h3, alt, title). Przygotowanie odpowiednich meta title, description, keywords oraz grafik na potrzeby danej podstrony. Teksty zostaną przez nas dostarczone. Prośba o podanie ceny za taką usługę dla 1 podstrony: - przygotowanie podstrony wp, elementor + grafiki Podstr...

Hi I need to very basic example on how to call a rest api from Aveva using a put command. It should be build importing .net libs.

I'm in need of a skilled .NET MVC Core developer to build a real estate web application similar to propertyfinder.ae. I'm looking forward to working with a developer who has: - Extensive experience with .NET MVC Core - Experience in building scalable web applications.

I need a C# .NET app that can access real-time stock data. The ideal candidate should have experience with Alpaca API and Blazor Tailwind CSS. I already have 2 small skeleton projects to start with, using Highcharts in Blazor. Key Features: - Accessing real-time stock data from Yahoo Finance, and trade information from Alpaca - Supporting basic trading functionalities including Buy/Sell orders, Portfolio management, and Price alerts - Displaying Highcharts Please include some examples of similar projects you've worked on, and how you would approach the integration of the specified features in your bid.

I'm seeking an expert developer to help me create a comprehensive ticket booking platform. Here's a rundown of what I'm looking for: - **Client Website**: The website should be user-friendly and responsive, accessible on both web and mobile (Android and iOS) devices. - **Payment Integration**: I want to offer various payment methods to users, including credit/debit cards, digital wallets, and net banking. - **Backend CMS for Theatres**: The system should provide a backend panel for theatres to manage showtime schedules and other related tasks. - **Admin Panel**: An admin panel is needed to monitor and manage the entire system, including the theatres. - **Mobile App**: A mobile app should be developed to allow users to book tickets conveniently.

I am looking for a seasoned .NET developer with specialized expertise in API creation and .NET core framework to assist us in developing a brand new application. This project will require an innovative mind who has the ability to think creatively, solve problems and work efficiently. This is for a hospitality business. Key Responsibilities: - Develop new APIs and integrate with Frontend - Develop frontend UI with html, css, Javascript, bootstrap * Cart Functionalities * Order Creation * Menu * Order Placement Ideal Candidate: -Prior experience in creating applications using Entity Framework -Strong understanding and hands-on experience with MySQL -Demonstrable .NET development skills -Ability to work independently and deliver within deadlines.

I am looking for a seasoned .NET developer with specialized expertise in API creation and .NET core framework to assist us in developing a brand new application. This project will require an innovative mind who has the ability to think creatively, solve problems and work efficiently. This is for a hospitality business. Key Responsibilities: - Develop new APIs and integrate with Frontend - Develop frontend UI with html, css, Javascript, bootstrap * Cart Functionalities * Order Creation * Menu * Order Placement Ideal Candidate: -Prior experience in creating applications using Entity Framework -Strong understanding and hands-on experience with MySQL -Demonstrable .NET development skills -Ability to work independently and deliver within deadlines.

I'm in need of a WPF form specialized in number validation, focusing primarily on calculation purposes. This project will feature: - Data input and validation: The functionality should allow the user to input various numerical data. Upon entry, this data should be automatically validated through programmatic checks to ensure the data's integrity and accur...calculations. The validated data will be used for calculation purposes. Therefore, the validation must be rigorous in checking for numerical inconsistencies. Ideal skills for this project include extensive experience in WPF form design and development, deep understanding of data validation (particularly with numerical data), and experience in developing systems used for calculations. Familiarity with .NET and C# would...

I am looking for a seasoned .NET developer with specialized expertise in API creation and .NET core framework to assist us in developing a brand new application. This project will require an innovative mind who has the ability to think creatively, solve problems and work efficiently. This is for a hospitality business. Key Responsibilities: - Develop new APIs and integrate with Frontend - Develop frontend UI with html, css, Javascript, bootstrap * Cart Functionalities * Order Creation * Menu * Order Placement Ideal Candidate: -Prior experience in creating applications using Entity Framework -Strong understanding and hands-on experience with MySQL -Demonstrable .NET development skills -Ability to work independently and deliver within deadlines.

I'm seeking an expert .Net MAUI mobile app developer to help enhance our existing app with new features. The primary additions I require are a Doctor Appointment and Payment Gateway Integration, particularly with an emphasis on a modern and sleek design approach. Key Skills & Experience: - Proficiency in .Net MAUI - Proven experience with integrating appointment booking and payment gateways into mobile apps - Strong understanding of UX/UI and ability to deliver modern, sleek designs - Prior work on integrating mobile banking payment gateways preferred The ideal candidate will be able to not only add these features seamlessly into the existing app, but also ensure that the user experience remains intuitive and visually appealing. Your expertise will be key in making...

...(or program) that running on java or .net that can send messages via facebook messenger (do not use Facebook APIs) using Selenium or other automation frameworks you are familiar with (if you use other automation frameworks, you must notify me for confirmation). Key features: 1. Log in with the provided the user/password. 2. Send messages to specific Facebook users with provided information. 3. Send Messages from more than 2 senders to specified receiver in a short time. 4. Receive messages from Facebook users in real time (can get username information, message content). 5. Facebook will not block messages for spam reasons (the limitation is defined by you). Must-have skills: Java (familiar with Spring Boot) or C# programming skills (familiar with .Net core) Nice to have: S...

Job: Change field names in vb source code according to Excel table (from/to)

I am looking for a seasoned full stack software engineer specializing in .Net and Angular. The aim of this project is to build an e-commerce platform promising seamless B2B transactions. Key functionalities that are expected to be incorporated include: - Facilitating data storage and retrieval - Real-time notifications - User authentication and authorization Ideal Skills and Experience: - Proficiency in .Net and Angular - Proven experience building e-commerce platforms - Understanding of user experience in a B2B environment - Knowledge of data management and real-time notification systems With your help, I look forward to providing businesses a convenient, easy-to-navigate and highly functional e-commerce platform.

Job Title: Full-Stack Developer for WordPress, .NET Middleware, Azure Integration, and SDK Development Job Overview: We are seeking an experienced Full-Stack Developer to spearhead the development and integration of key system components within our e-commerce platform. The successful candidate will lead initiatives to enhance user interactions by developing a WordPress plugin, building a robust .NET middleware API, and integrating advanced Azure-based messaging services. Additionally, the role involves creating an SDK to facilitate easy integration for third-party AI bot services. This position is crucial for ensuring that our platform not only meets current technological standards but also adapts to future advancements and user needs, enhancing both the scalability and func...

vb 2012 .net record video and sound. Autosave to file when motion/sound is detected. exe File must be compact and small and not dependent on other dll or ocx. Auto detect existing cam and video. Ability to read/write to a registry key.

I require a proficient developer to design a functional asp.net / vb template which will be the foundations of an internal business tool/website. A very BASIC MS SQL schema will be provided for Functionality to interact with. The project includes: The development of a lightweight css, jquery design that is simplistic but still looks ok. Static Pages - Home - Contact Us - About Us Functionality Pages - User Registration - User Login - User self management) - Password reset via email. - User Management admin The sample should show, connecting to an ms sql database. Displaying data through a non defined data source eg (a query enbeded in the code) as well as a defined Datasource. The site should use headers and footers. VS2022, has a sample site, it could be possible to simply...

...my fully completed project. Given that no specific API endpoints have been defined, your role would be to link and facilitate seamless communication between the front-end developed with and the back-end written in .Net. Here's what you'd need to achieve: • Integrating endpoints with front and backend • Ensuring secure and efficient transfer of user information, payment transactions, and product details through these APIs To help you in this project, I have a complete API documentation ready. The ideal candidate would have: • Expertise in and .Net • Proven experience with API integration • Good problem-solving skills and attention to detail Your bid should cover all these aspects and include examples of previous similar work yo...

We're in search of a highly versatile .NET developer for our undisclosed project. While we haven't stated specific skills or project type, candidates should have: - Broad knowledge in .NET and its most popular programming languages (i.e., C# programming, ASP.NET development, and SQL database) - Experience in various .NET projects (i.e., web and desktop applications, as well as enhancement of existing .NET applications) - Proficiency in Windows, Linux, and Mac development platforms Your flexibility and adaptability are our key considerations as project specifics will be discussed upon engagement.

We're in search of a highly versatile .NET developer for our undisclosed project. While we haven't stated specific skills or project type, candidates should have: - Broad knowledge in .NET and its most popular programming languages (i.e., C# programming, ASP.NET development, and SQL database) - Experience in various .NET projects (i.e., web and desktop applications, as well as enhancement of existing .NET applications) - Proficiency in Windows, Linux, and Mac development platforms Your flexibility and adaptability are our key considerations as project specifics will be discussed upon engagement.

I'm seeking an expert who can help me integrate Kafka and UiPath for the purpose of automating specific business processes that involve financial transactions. Key Responsibilities: - Develop a seamless integration between Kafka and UiPath, using code stage in C# or .Net Skills and Experience: - Proficiency in Kafka and UiPath - Proven track record in automating - Strong understanding of data streaming and business automation - Ability to provide clear documentation for the implemented solution Please bid if you have relevant experience in this domain and can deliver a robust and efficient solution for our needs.

I'm looking for an individual or team capable of collecting question papers. Specific details include: - The collection should start from 2018 papers until the present. - The task involves all subjects in which UGC and CSIR NET are conducted. - Both solved and unsolved question papers should be collected. - The question papers are to be compiled as PDF files. This project demands individuals with experience in research and knowledge about UGC and CSIR NET examinations. Proficiency in managing and compiling data is essential.

I'm looking for a skilled .Net and Angular developer who can create an intuitive report generation system. The reports in question have not been specified - they could range from financial to sales or inventory reports. Required Skills and Experience: - Strong experience in .Net - Strong experience in Angular - Prior report development experience Project Details: - Generate dynamic reports based on user input & getit downloaded or send by email. - As the types and purposes of reports have not been defined, flexibility and adaptability are required from the developer. - Ensuring the functionality and efficiency of the system is paramount. Please include relevant examples of your previous work in your bid. We initially require sample report like this with bar cod...

Create Tensor net ai thumbnail

Please start your proposal by saying "hello MBA student" I am looking for a skilled data scraper who can efficiently extract specific data from a football website (). and one more for average age of squad. Extraction will need to go CSV Key Tasks: - Extracting 'Average Age of Squad' information - Extracting 'Net Spend' data Ideal Skills: - Proficiency in data scraping - Understanding of football statistics - Experience with similar projects or websites is a plus I trust your expertise to advise if additional information is needed for successful execution. Experience and accurate, meticulous work is what this project calls for.

I'm looking for a skilled developer to help me integrate Billdesk Payment Gateway on my ASP.NET platform. Key Requirements: - Integration with Credit cards, Debit cards, Net banking, and UPI - No support needed for recurring payments Your Expertise: - Strong background in ASP.NET and Payment Gateway Integration - Proven experience with Billdesk Payment Gateway is a plus - Familiarity with the Indian payment landscape is beneficial

I'm looking for a seasoned fundraising professional to provide expert advice ...seasoned fundraising professional to provide expert advice in crowdfunding and engaging private investors. The goal amount for this campaign is more than $50,000. Our target audience primarily consists of high net-worth individuals. Key Responsibilities: - Advise on effective crowdfunding strategies. - Offer insights on how to engage private investors. - Suggest tactics for appealing to high net-worth individuals. This project would be ideal for someone with a solid background in fundraising, particularly in crowdfunding and investor engagement. Experience in reaching out to high net-worth individuals would be a significant plus. If you've successfully managed fundraising projec...