Blood bank management vb source punët

Filtër

Kërkimet e mia të fundit
Filtro sipas:
Buxheti
deri në
deri në
deri në
Lloji
Aftёsitё
Gjuhët
    Shteti i punës
    2,000 blood bank management vb source punët e gjetura, me çmimin EUR

    ...spoken everyday. Availability: ASAP Main responsibilities: The ideal candidate is expected to carry out the following duties both in Russian language: Sales: first point of contact for advices and general enquiries from prospects: what products to buy, prices, offers, quotations, advises on design, colours, sizes, expected delivery times, guarantees, sales policies, etc… Order management: checking clients’ artwork, verifying colours, making graphic files quick fixes and modifications using Photoshop, coordination for the manufacturing and approval of samples Post sales support: helping customers solving problems with deliveries, tracking parcels online (EestiPost, Omniva, DPD, TNT, FedEx, UPS, etc…) handling issues reported by clients with p...

    €14734 (Avg Bid)
    €14734 Oferta mesatare
    5 ofertat
    qefqreqweqawdafsc Ka përfunduar left

    asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

    €182 (Avg Bid)
    €182 Oferta mesatare
    1 ofertat
    yveguwvcjnjnecbkhb Ka përfunduar left

    ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

    €104 (Avg Bid)
    €104 Oferta mesatare
    1 ofertat

    nhjkmbjkgugyufyufykjkhiu kiuy7yubnbjhggggghutyurrtr lbhrffyyffdfhbjjhgyfgjkgggnjhjvdrtstghjgszzxfvhjjhgjhjjsrdfjpooouiuyui

    €28 - €230
    €28 - €230
    0 ofertat
    Management System Ka përfunduar left

    nhjkmbjkgugyufyufykjkhiu kiuy7yubnbjhggggghutyurrtr lbhrffyyffdfhbjjhgyfgjkgggnjhjvdrtstghjgszzxfvhjjhgjhjjsrdfjpooouiuyui

    €138 (Avg Bid)
    €138 Oferta mesatare
    1 ofertat

    ...account has been compromised and I need assistance in reclaiming control over it. This involves identifying the source of the breach and securing the account. - Setting up a New Ad Account: Due to security concerns, I'm looking to establish a fresh ad account on Facebook. This would require seamless migration of existing campaigns and ensuring they continue to perform optimally. - Enhanced Security & Integration: It's imperative that the new ad account and my FB page are equipped with heightened security measures. Additionally, I would like the transition to be smooth and integrated with existing tools and platforms. Ideal Skills: - Proficient in Facebook Page and Ad Account Management - Experienced in Handling Account Security and Unauthorized Access Issues...

    €13 / hr (Avg Bid)
    €13 / hr Oferta mesatare
    18 ofertat
    Directory Listing Website 6 ditë left
    VERIFIKUAR

    ...load quickly and be highly performant. - Import Functionality: Ability to import an Excel file so that entries are automatically created in the backend. 2. Design and User Interface: - Pixel-Perfect: The highest priority is given to a pixel-perfect implementation of the provided design. - Favorite Lists: Users should be able to create and rename multiple favorite lists. 3. Project Management: - Timeline: Please provide an estimated timeline for the completion of the project. - Communication: Regular updates and meetings for progress review are required. Proposal Requirements: 1. Portfolio: Please submit a portfolio of your previous work, especially similar projects in the directory listing website category. 2. Cost Estimate: A detailed cost estimate, including ...

    €2074 (Avg Bid)
    €2074 Oferta mesatare
    63 ofertat

    ...campaigns and help me with the verification process. Key Tasks: - **Campaign Management:** I need someone who can create and optimize campaigns for me, ensuring they are running effectively and meeting my goals. - **Keyword Optimization:** A deep understanding of keyword research and optimization is crucial in ensuring my campaigns are attracting the right audience. - **Tags Manager:** Prior experience working with Google Tag Manager is a plus, as I'd need support in setting up and maintaining the tags. - **Verification Assistance:** I need help with the Google Ads verification process for my business operations. Ideal Candidate: - Proficient in Google Ads, with a proven track record of successful campaign management - Skilled in keyword research and optimization -...

    €159 (Avg Bid)
    €159 Oferta mesatare
    28 ofertat

    In this project, I need a freelancer who can meticulously manage data entry tasks. Ideal Skills: - Strong data entry skills, specifically with text data. - Advanced knowledge of Excel and data management within it. - Ability to understand and follow custom data organization instructions. Job Summary: - Enter text data into Excel format, understanding the importance of accuracy. - The data must be organized in a specific, custom order that I will provide. - Experience in similar jobs and a keen eye for detail will be highly beneficial.

    €8 / hr (Avg Bid)
    €8 / hr Oferta mesatare
    5 ofertat

    I need a hand in mastering the use of MS Outlook. Specific tasks I require assistance with include: - Managing and organizing my contacts - Sorting and structuring my emails - Creating folders for better email management - Effective calendar management via Nextech EMR Moreover, I am unsure if linking Outlook to Teams or iCloud might boost my productivity. Hence, I need advice on possible integrations and synchronization with other platforms. The ideal bidder is proficient in MS Outlook, with experience in Teams or iCloud, and EMR systems, especially Nextech. Your ability to provide practical, simple solutions is highly valued. ( I WOULD NOT EXPECT MY TUTOR/ASSISTANT TO KNOW NEXTECH :) ) Completion of the project should ideally be within a month.

    €26 / hr (Avg Bid)
    €26 / hr Oferta mesatare
    8 ofertat

    I am developing a system, which integrates a donchian channel along with a strategy, but has the pinescript code hidden. I need someone who can figure it out somehow.

    €106 (Avg Bid)
    €106 Oferta mesatare
    8 ofertat
    Social media 6 ditë left
    VERIFIKUAR

    ...social media management and content creation. 2. Knowledge of relevant social media platforms for Gacox Marketing (e.g., Instagram, Facebook, TikTok). 3. Ability to develop a coherent content strategy aligned with Gacox Marketing's objectives. 4. Capability to research and understand Gacox Marketing's target audience. 5. Creativity and design skills to create visually appealing content (photos, graphics, videos, etc.). 6. Basic understanding of SEO and how to optimize content for each platform. 7. Strong writing and communication skills to craft persuasive captions and messages. 8. Awareness of current social media trends and ability to adapt to changes in the digital landscape. 9. Ability to schedule and program social media posts for a 30-day period. 10. Excellent tim...

    €139 (Avg Bid)
    €139 Oferta mesatare
    32 ofertat

    I'm looking for an intermediate SAP administrator to assist with the basic administration of our SAP system. Key Tasks: - Basic user management, including creating and deleting users, assigning roles, and setting up authorizations - Monitoring system performance and taking necessary actions to ensure it runs smoothly - Troubleshooting and resolving basic configuration and authorization issues - Assisting with system backups and ensuring data integrity - Providing general support to the team on SAP-related queries It's important that you're comfortable working with the SAP system and have a good understanding of its basic functions and administration. A background in SAP Administration or similar roles is preferred. I will provide access to the SAP system, so you ...

    €30 / hr (Avg Bid)
    €30 / hr Oferta mesatare
    18 ofertat

    Preferred Commnications and Wi-Fi, Inc. is looking for Watchguard firewall techs for both firewall and endpoint security pre-Install config. and support. Requirements: - In-depth knowledge of hardware firewalls and their functionalities. - Expertise in intrusion detection systems. - Experience with high-risk threat detection and response. - Capable of ...hardware firewalls and their functionalities. - Expertise in intrusion detection systems. - Experience with high-risk threat detection and response. - Capable of optimizing firewall settings for maximum security. I am looking for a professional with a sterling track record in enhancing hardware firewall intrusion detection capabilities. If you are up to the task and confident with high-risk threat management, I would like to hear...

    €64 / hr (Avg Bid)
    €64 / hr Oferta mesatare
    5 ofertat

    ...Optimize database performance through indexing, query optimization, and other performance tuning techniques.  Develop and enforce data standards and best practices to ensure data integrity and security.  Provide technical guidance and mentorship to junior developers.  Troubleshoot database issues and provide timely resolution.  Stay up-to-date with the latest trends and technologies in database management and architecture. Skills and Qualifications  Bachelor's degree in Computer Science, Information Technology, or a related field. Master's degree preferred.  8+ years of total experience.  Minimum of 5 years of experience in database architecture and development, with a focus on Netezza and Oracle.  Proficiency in SQL and PL/SQL programming languages.  St...

    €669 (Avg Bid)
    €669 Oferta mesatare
    3 ofertat

    ...with a few specific functionalities such as user registration and login, payment processing and also payment privacy capability - the user wallet within the dapp must have the capacity to hide the original sender's wallet and send from the dapps user wallet for anonymity - It will need to be able to include text/image features. - Despite the checkboxes above, I am undecided whether a content management system is needed, so your advice on this would be invaluable. Desired Experience and Skills: - Exposure to and understanding of the Pi Network's blockchain - Proven experience in website conversion to web3 -ability to code - Dapp design and development expertise - Familiarity with integrating functionalities such as user registration, login and payment processing. - Id...

    €32 / hr (Avg Bid)
    €32 / hr Oferta mesatare
    24 ofertat

    I am seeking an experienced DevOps engineer to scale down my Red Hat OpenShift configuration currently running on AWS. The primary tasks involve reducing: - Application instances: Currently, I have 1-5 instances running, and I need to scale it down to a single instance. - Compute resources: The reduction should align proportionately wi...workerocs (using m5.2Xlarge and m5.4xlarge) along with a bootnode and bastionhost) and the volumes (26 of them with 6.23 TB of storage being used) and it is way overkill for just using as a sandbox to learn in and educate. They had no other Template option when installing. Ideal Skills & Experience: - Expertise in handling Red Hat OpenShift environment - Strong knowledge of AWS and instance management - Prior experience in application &...

    €485 (Avg Bid)
    Urgjent
    €485 Oferta mesatare
    15 ofertat

    ...highly engaging and insightful educational articles for a weekly newsletter I'm launching. Key Points: - **Target Audience**: My newsletter is exclusively aimed at freelancers. The content should be tailored to their needs, challenges, and aspirations in the freelancing world. - **Content Type**: I'm looking for educational articles. These could cover topics like freelance productivity, time management, client relationship building, skill enhancement, and so forth. - **Frequency**: You'll be required to produce this content on a weekly basis. Ideally, you should have: - **Proven Experience**: To be considered, you should have a strong portfolio of writing within the freelancing or related industry, particularly in producing educational content. - **Research Ski...

    €99 (Avg Bid)
    €99 Oferta mesatare
    33 ofertat

    I am looking for a skilled Django developer to help me build a simple CRUD system. This system needs to primarily manage employees and facilitate the transfer of their personal details with basic report within the organization. Key Features: - Employee Management: The system should allow me to add, edit, and delete employee information. - Information Transfer: This is a key feature, so I need to be able to easily transfer employee personal details within the organization. see the attached file for more details Please reach out if you have the necessary skills and experience for this project.

    €68 (Avg Bid)
    €68 Oferta mesatare
    27 ofertat

    ...real estate listings. It should be visually appealing, user-friendly, and easily navigable. - Integrated CRM system to manage and track leads effectively. This system is crucial for our business to convert leads into sales. - The CRM should include sales pipeline management functionality, allowing for easy tracking of prospects through the sales cycle. Ideal Skills & Experience: - Proficiency in web development, with a strong portfolio of real estate websites. - Expertise in CRM integration, particularly with sales pipeline management. - Experience in building lead generation features within websites. As a real estate business, our goal is to present our listings online and effectively convert visitors into customers. Please provide examples of similar projects you&#...

    €177 (Avg Bid)
    €177 Oferta mesatare
    57 ofertat
    Trust Fund Liquidation Advisor 6 ditë left
    VERIFIKUAR

    I am currently in a position where I want to have full control over my money. I am intending to dissolve my trust fund for this reason. This is an important step for me and I require professional input to guide me through this process. I am searching for someone with a strong background in financial management, particularly in trust funds. Knowledge in investment tracking is essential, alongside the capability of providing me a system where I can manage, monitor and make decisions about my finances independently. Additionally, the right candidate will be someone capable of: - Guiding me through the dissolution of my trust fund - Helping me establish full control and decision-making authority over my finances - Setting up a system for my independent financial control This is sub...

    €17 / hr (Avg Bid)
    €17 / hr Oferta mesatare
    18 ofertat

    I'm in need of a cutting edge informational website for my business. The primary objective of this website is to encourage visitor interactions and prompt them to reach out to me. the company has been here since 1997 but we are now under new management since december 1st and we have remodeled and revamped the space we are a printing and copy shop but we have so many other services that we provide. I already have the domain name that I would like to use for my business Key components that need to be integrated into the homepage include - Testimonials: Displaying positive feedback and comments from satisfied clients will help in building credibility. - Featured Services: A section that highlights my main services or products, showcasing their value and benefits to the visitors. ...

    €152 (Avg Bid)
    I cilësuar Urgjent
    €152 Oferta mesatare
    105 ofertat

    I require an informative, easy-to-navigate website for my removal service business. The site should promptly present our services and provide detailed information about our company and team. Key features required: - User-friendly interface - Company Colors are Navy Blue, Burnt Orange, White, Black, and Grey. We would love to stick to ...send an email if they have any questions or feedback - Contact section for (Google Maps, Address, Phone, Email, and Business Hours) - Our Slogan is" IN MOST CASES WE PAY YOU " (MUST BE ON THE HOME PAGE BIG ENOUGH TO CATCH VISITOR'S ATTENTION) Ideal Skills and Experience: - Proven experience in website design and development - Strong understanding of user-interface design - Excellent time management skills with the ability to ...

    €387 (Avg Bid)
    €387 Oferta mesatare
    116 ofertat

    ...chain for lithium-ion batteries. As my study progresses, I seek to leverage the expertise of a seasoned professional in the arena of IoT with an intimate understanding of Python programming and cloud data management. Key Objectives: - Identify potential applications of IoT within the specified context - Evaluate the feasibility of implementing IoT solutions in the supply chain - Analyze the impact of IoT on the supply chain for lithium-ion battery production Ideal Candidate: - Extensive experience with IoT and its applications - Proficient in Python development and cloud data management - Comprehensive understanding of supply chains, specifically in lithium-ion battery manufacturing - Familiarity with PLC & SCADA, Edge Computing, wireless sensors and gateways - Str...

    €238 (Avg Bid)
    €238 Oferta mesatare
    5 ofertat

    ...looking for a freelancer who can create a comprehensive, user-friendly Google Form and Excel template system. This system will be geared towards the hotel management sector and will be used for recording bookings, sales, expenses, and other business-related data. Key Requirements: - Design and Implementation of Google Form: The form should be intuitive and easy to use. It should have fields for recording bookings, sales, expenses, and other relevant business information. - Excel Templates: The gathered data from the form should be integrated into a set of Excel templates. These templates should be professionally designed and easy for hotel management to use. Your Role: - Your role will be to create a system that can manage multiple businesses. The system should serve as ...

    €11 (Avg Bid)
    €11 Oferta mesatare
    35 ofertat

    I'm ...market analysis specifically focusing on Lucknow real estate market. - Recommend the most suitable real estate project type (residential, commercial, mixed-use) based on the market analysis. - The DPR should contain detailed information on the land area available (200 acres) and how it will be utilized in the project. Ideal skills and experience: - Proven track record in real estate project management and DPR development. - Deep understanding of the Lucknow real estate market. - Excellent financial analysis and forecasting skills. - Strong communication and presentation skills to ensure the report is engaging and persuasive for potential investors. If you're confident in your ability to deliver a high-quality DPR that will attract investors to the project, I'...

    €98 (Avg Bid)
    €98 Oferta mesatare
    15 ofertat

    App Requirements - **User Management:** Account creation and login via email or Google account, admin panel for managing user accounts. - **User Profile:** Profile completion with name, photo, description, and payment information. - **Geolocation and Filters:** Find nearby services using geolocation, filter services by category, distance, etc. - **Service Posting:** Service providers can publish services with details, photos, and prices, users can view service details. - **Messaging:** Integrated messaging system for users and service providers. - **Payment System:** Secure payments for services, admin management of transactions and commissions. - **Admin Panel and Statistics:** Dashboard for managing users, services, and transactions, view usage statistics and reports. - **T...

    €2652 (Avg Bid)
    €2652 Oferta mesatare
    101 ofertat
    Crypto Mining Sales Page Design 6 ditë left
    VERIFIKUAR

    You need to create an attractive product sales page on mining website and need the source code in html. Also you have ability to add some content according to my needs. My website is just from scratch. Also need to add 3 package for the mining to buy by customer. Also add Login Register button. And also add PayPal earning, bank transfer, Usdt withdrawal earning proof to the sales page and also need to add Tidio plugin, also if anything need to add, I can contact you. My budget is $50 Must have experienced on creating crypto website.

    €94 (Avg Bid)
    €94 Oferta mesatare
    19 ofertat

    I need an expert to configure my email accounts for Domains 1, 2, and 3. In addition, I require the design and implementation of tailor-made survey forms based on a specific model I have in mind. - Email Configuration: I need my email accounts to be set up in an efficient way in these three domains. You should be experienced in domain management and email setup. - Form Creation: I will provide a specific model for the survey forms that need to be created. Previous experience with custom form creation and design is a must. Looking to get this project completed as soon as possible. Those who can deliver fast results will be given higher consideration.

    €42 (Avg Bid)
    €42 Oferta mesatare
    23 ofertat

    ...Google Cloud AI Platform Amazon SageMaker Microsoft Azure Machine Learning Hugging Face Transformers Dialogflow ManyChat MobileMonkey Additional Requirements: Understanding AI Technology: Knowledgeable about AI technology and its applications for business automation. Building Solutions: Ability to build custom AI-powered automation solutions using various platforms and technologies. Project Management: Ability to manage automation projects from initial concept to final delivery, including iterating based on market feedback. Client Relations: Building trust with clients by delivering initial low-cost solutions and upselling to higher-ticket offers. Be able to leverage ai tools and have the following conversations: 1. "We've moved beyond automation and are now lever...

    €17 / hr (Avg Bid)
    €17 / hr Oferta mesatare
    9 ofertat

    Our existing CGI script is encountering issues when importing the exam's section breakdown from a .dat file. Due to this, we are unable to import the breakdown of results per section of the exam into the SQL database. We are seeking a ...proficient developer who can: - Analyze our existing CGI script and identify the cause of the breakdown import issue. - Provide actionable advice and steps to troubleshoot and resolve the problem. - Ensure the script effectively imports the section breakdown from the .dat file as intended. The ideal candidate for this project should have: - Extensive experience in CGI scripting and SQL database management. - Proficiency in handling and troubleshooting data import/export issues. - Ability to work quickly and efficiently, as we need this probl...

    €20 / hr (Avg Bid)
    Urgjent MRS
    €20 / hr Oferta mesatare
    2 ofertat

    I am seeking a skilled professional to develop a PowerApps timesheet that is compatible with web platforms. This digital timesheet must possess certain features, including: - The ability to enter time for specific tasks - The capability to generate monthly reports - A system to approve timesheets by project managers This project does ...generate monthly reports - A system to approve timesheets by project managers This project does not require adherence to any specific branding requirements. Ideal candidates will have previous experience and a strong skillset in PowerApps and timesheet software development. Familiarity with web compatibility is a plus. Please provide examples of similar work in your proposal. Communication and time management skills are essential for successful co...

    €38 / hr (Avg Bid)
    €38 / hr Oferta mesatare
    9 ofertat
    Money Management App Development 6 ditë left
    VERIFIKUAR

    App iOS with masaniello (money management). I can share a similar example.

    €194 (Avg Bid)
    €194 Oferta mesatare
    19 ofertat

    ...strategy for my website * Identify and analyze appropriate keywords. Currently, we are focusing on service-based terms specifically, ‘deck staining’ * Monitor and analyze SEO statistics such as redirects, click rate, bounce rate, and others Requirements: * Proven SEO experience * Knowledge of standard and current SEO practices * Experience with SEO reporting * Strong organizational, time management, and analytical skills This position would be ideal for an SEO specialist who has previously dealt with similar projects. A proven track record in increasing Google search rankings is essential. I am looking forward to working with someone who can help me improve my business's online presence and visibility. Please make sure you share your past experiences an...

    €324 (Avg Bid)
    €324 Oferta mesatare
    63 ofertat

    ...reasons. Tasks: - Data Entry: You will be required to handle data entry tasks efficiently and accurately. - Social Media Management: I need assistance in managing my social media accounts, including content posting and engaging with my audience. - Account Management: You will handle various aspects of account management, which will require attention to detail and a proactive approach. Duration and Hours: - The project duration is one month. - I expect you to work less than 10 hours per week. Ideal Skills: - Proficient in data entry and management. - Experienced in social media management, with a deep understanding of various platforms. - Prior experience with account management is a plus. - Excellent communication skills are essential. Ple...

    €4 / hr (Avg Bid)
    €4 / hr Oferta mesatare
    7 ofertat

    My project requires an experienced programmer who has the technical abilities to modify an XSL style sheet and adjust its layout. The task will specifically focus on: - Changing the layout of the style sheet and VB code. This modification is needed to appropriately accommodate some new fields that have been added to an import file. - Improving the style sheet so as to automatically map the new fields from the import file. The ideal candidate for this job should have experience with layout adjustments in XSL style sheets, automatic mapping of new fields and VB coding. Your skills and experience in rearranging content layout, updating fonts & colors, and altering data display formats will be highly appreciated. Don't hesitate to place your bid if you can deliver t...

    €139 (Avg Bid)
    Urgjent
    €139 Oferta mesatare
    27 ofertat

    Looking for a skilled developer to build a comprehensive contact management app for both iOS and Android platforms. This app should embody a minimalist and clean design, making it user-friendly and appealing to the eye. Key features that must be included are: - The ability to upload, categorize, and share there important contacts easily; users should not have to struggle to extend their connections. - Contact grouping feature; to keep things tidy and accessible, we require the functionality of grouping contacts Based on categories we choose. - The users should be able to access their family network contacts for categorize life events for ease of use. Ideal applicants will have experience in app development for both platforms and an eye for clean, minimalistic design. Showcasing p...

    €2342 (Avg Bid)
    €2342 Oferta mesatare
    114 ofertat

    I'm looking for a highly skilled wastewater engineer to undertake a project focused on reducing environmental impact, particularly through enhanced pollution control. The crucial task is to devise efficient ways of controlling suspended solids pollutants in wastewater. Proven experience in: - Wastewater management - Pollution control - Reducing environmental impact - Handling of suspended solids pollutants This project needs innovative strategies and practical engineering solutions to control pollution effectively. We are keen on minimizing our eco footprint and this initiative is an integral part of that.

    €2147 (Avg Bid)
    Urgjent
    €2147 Oferta mesatare
    13 ofertat

    I need assistance in creating a specialized budgeting spreadsheet focusing on drivers license renewal costs. As someone who understands the intricacies of financial data, your task encompasses the following: - Developing a budgeting spreadsheet with an emphasis on renewal ...budgeting spreadsheet with an emphasis on renewal fees. - Including a feature for expense tracking and an income versus expenses comparison. - Incorporating a mechanism for budget forecasts to plan my finances better. The ideal freelancer for this task should excel in financial data management and have a comprehensive understanding of Excel or similar platforms. Previous experience in creating budget planning or financial management tools would be a significant advantage. Let's simplify my financia...

    €5 / hr (Avg Bid)
    €5 / hr Oferta mesatare
    28 ofertat

    I'm in need of a skilled app developer to create a seamless and high-quality social networking app ...features - Incorporation of messaging and chat features - Integration of photo and video sharing capabilities The ideal candidate should have: - Extensive experience in app development for both iOS and Android - Proven track record of developing social networking apps - Strong background in incorporating multimedia sharing features, ideally in a social networking context - Excellent project management and communication skills - A keen eye for detail and user experience The app's success will hinge on its usability, smooth performance and the quality of the social networking features. A strong focus on these areas is crucial. Please include relevant samples of your previo...

    €368 (Avg Bid)
    €368 Oferta mesatare
    13 ofertat

    ...measures. Troubleshoot and debug issues. Stay up-to-date with emerging technologies and best practices. Requirements: Bachelor's degree in Computer Science, Engineering, or a related field. Minimum of 7 years of experience in web development. Extensive experience with and React.js. Strong proficiency in JavaScript/TypeScript, HTML, and CSS. Experience with GraphQL, RESTful APIs, and state management libraries (e.g., Redux). Solid understanding of server-side rendering (SSR) and client-side rendering (CSR). Experience with version control systems (e.g., Git). Excellent problem-solving and communication skills. Ability to work independently and collaboratively in a fast-paced environment. Bonus Skills: Experience with other front-end frameworks (e.g., Angular, Vue.js). Know...

    €4 - €8 / hr
    I vulosur
    €4 - €8 / hr
    16 ofertat

    I am looking for a knowledgeable freelancer who c...administration console and Factory Talk view studio. The main tasks for the training are: - Configuration and customization - Troubleshooting and support The freelancer should also focus on these modules: - User management - Data logging and reporting - Alarm management Ideal freelancer skills and experience: - Intermediate proficiency in Factory Talk administration console and Factory Talk view studio. - Proven experience in configuration, customization, troubleshooting and support. - Knowledgeable in user management, data logging, reporting, and alarm management. The goal of the project is to become proficient in using Factory Talk console and view studio after the training. The training sessi...

    €35 / hr (Avg Bid)
    €35 / hr Oferta mesatare
    4 ofertat

    ...Ubuntu for managing routers and modems remotely. My ultimate goal is to have a seamless and efficient remote device management system. Key responsibilities: - configure Genie ACS on Ubuntu - Set up the system to manage routers and modems remotely - Ensure the system is fully functional and secure Ideal candidate: - Proficient in Ubuntu and network management - Extensive experience with Genie ACS for remote device management - A strong understanding of TR-069 protocol - Excellent troubleshooting skills - Strong security background to ensure the system is robust I'm looking for someone who can work efficiently and independently to deliver a reliable remote device management system. Your experience with TR-069 protocol and Genie ACS should be at an exp...

    €108 (Avg Bid)
    €108 Oferta mesatare
    5 ofertat

    ...and management: You'll need to be well-organized and have strong data entry skills to keep track of customer information and orders. - Lead generation: Experience in B2B lead generation is a must. You should be able to identify and reach out to potential business partners. Additional tasks: - Facebook ads: You'll be in charge of managing Facebook ads to promote our products and services. - Ecommerce: A solid understanding of the Shopify platform is essential as you'll be working within this system. - Digital marketing: Knowledge of digital marketing strategies will be helpful as we work on expanding our online presence. Ideal candidate's skills and experience: - Customer service experience - Data entry and organization skills - B2B lead generation strategie...

    €9 / hr (Avg Bid)
    €9 / hr Oferta mesatare
    48 ofertat

    ...virtual assistant to support me during typical work hours, 9am to 5pm (UTC +1). The ideal candidate will possess the following expertise: CRM MANAGEMENT: Monitor and manage follow-ups and sales activities within the CRM. Update and maintain accurate records of customer interactions and sales leads. Assist in developing strategies to improve CRM processes and efficiency. Customer Service: Respond to customer inquiries and resolve issues promptly and professionally. Maintain a high level of customer satisfaction through effective communication and problem-solving skills. Liaise with other departments to ensure customer needs are met. Email Management: Monitor and manage the CEO's email inbox, prioritizing and flagging important messages. Draft, proofread, and send em...

    €4 / hr (Avg Bid)
    €4 / hr Oferta mesatare
    28 ofertat

    ...of their groceries. The app provides a simple and user-friendly interface for adding grocery items, viewing current inventory, and receiving notifications before items expire. The goal is to create a useful tool with AI features to help enhance user experience Key Features - Using Flutter + Gemini-API User Authentication: Sign in and create new accounts Edit profile and preferences Pantry Management: Display a list of scanned groceries Add new items via a plus button, redirecting to the camera for scanning food receipts or item barcodes Edit and delete existing items Overview of current pantry inventory Photo recognition for groceries using Gemini API Gemini-API-based recipe recommendations based on pantry items Integration with barcode databases for easy item entry Notificat...

    €225 (Avg Bid)
    €225 Oferta mesatare
    50 ofertat

    My project involves packaging a Java application into a Docker image compatible with CentOS. This will extend the application's portability and scalability. Ideal Candidate: - Familiarity with Docker and Docker container management - Proficiency in CentOS Linux distribution - Experience packaging Java-based applications into Docker Images Requirements: - Transform the provided Java (or others compiled) program into a Docker image - Ensure the Docker image is fully compatible with CentOS - Verify the Dockerized Java program runs without hiccups on CentOS systems.

    €407 (Avg Bid)
    €407 Oferta mesatare
    43 ofertat
    Assistant: Contact List 6 ditë left
    VERIFIKUAR

    Seeking assistant for contact research, Data entry for contact phone & emai...for the following U.S States: 1. Utah ( Primary Home State) 2. Nevada 3. Idaho 4. Wyoming 5. Arizona 6. New Mexico 7. Colorado -Locate all Roofing companies by state and compile a list for me to email & offer property claim insurance services. - Locate all Restoration & Mitigation Companies by state to offer insurance property claim services. Contact Emails for HR preferred/ management. Email & Phone compiled into a spreadsheet or what you see best fit for a email list to send out. I am based in Utah so starting homebase and spreading out to surrounding states after. would like to have 100+ roofing companies by state. 100+ mitigation companies by state. 100 + Rest...

    €836 (Avg Bid)
    €836 Oferta mesatare
    38 ofertat

    ...news content. Objectives: Main Goal: Develop a web application that personalizes news content for users based on their reading habits and preferences. Secondary Goals: Implement data visualization features to display trends and sentiment analysis of news articles. Minimum Requirements: Content Aggregator: Develop a system that pulls news data from various APIs or web scraping. User Profile Management: Create functionality for users to register, login, and specify their interests and preferences. Recommendation Engine: Implement a machine learning model to analyze user behavior and curate news content accordingly. Optional Enhancements: Sentiment Analysis: Integrate a sentiment analysis model to evaluate the tone of news articles, helping users understand the general sentiment o...

    €28 (Avg Bid)
    €28 Oferta mesatare
    3 ofertat